Conserved Protein Domain Family
Gryzun

?
pfam07919: Gryzun 
Gryzun, putative trafficking through Golgi
The proteins featured in this family are all eukaryotic, and many of them are annotated as being Gryzun. Gryzun is distantly related to, but distinct from, the Trs130 subunit of the TRAPP complex but is absent from S. cerevisiae. RNAi of human Gryzun blocks Golgi exit. Thus the family is likely to be involved with trafficking of proteins through membranes, perhaps as part of the TRAPP complex.
Statistics
?
PSSM-Id: 400324
View PSSM: pfam07919
Aligned: 42 rows
Threshold Bit Score: 713.613
Threshold Setting Gi: 684165561
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT01127      669 VKLPEgTPPPSFLSAAFVFKNGEGKAGEAALAQLTIRSDALANSVPIVLEELHLQFNSSIKPIVLRHSA-DAtatFFTKG 747  Sporothrix sc...
XP_012738833  136 VVLQG-RDIHSFLCATFVFEQAEGKVGEPCTSQLSVMSFASKGSSPVTMAEIKIKFEGSLKPVTIRHSS-EAqdvEVRPD 213  Pseudogymnoas...
CCE35055      616 IQLSD-DVASPLISSSFVFRTKESKAGDYCKAQLALTSHAMPGSSPIRLSSVRVDFQTGLKPITVDHASsETgdeASTSR 694  Claviceps pur...
EFY90525      607 IQLSD-ASSSHLISSSFVFRSKENKAGDQCLAQFTLTSNAMADSMPISFSSVKILFEGSLKPILLQHGSsGEe------- 678  Metarhizium a...
CCD34406      638 IVLHA-EEVQSFLTASYAFEKSEGKVGEHSLSQLAIRSSALASSTPVTISEIRIEFTGSMKPILLRHKAnTEs-sETVKS 715  Botrytis cine...
XP_007293914  632 VVLHS-NEIHSFLSATYTFEHAEGKVGELCPSQLVVTSVAIPTAASVTISDIKITFNGSMKPVVLSHRAiDDg--LDQSP 708  Marssonina br...
XP_008080394  625 VVLHE-SEVHSFLSATFLFERLEGKVGEASRSQCVVTSSALPTSTPVTMTSLQIDFEGSMKPIIIRHKAmEEtrsAPGNP 703  Glarea lozoye...
XP_007776772  667 VSLTS-KSTLSPLSTSFTFAHDEGHVGEPLRAQLVFQSRAQRSSAPVVLSAVKVGLTGSLEEIRISHKPsPSgppSSPGK 745  Coniosporium ...
EKG17579      666 INLRT-RDIMSCISITAEFAVTEGHVAEPIFAQIAIRSNAHKGSNPIILNNLVVEFKGPLGSIKLTHA-------ETDGG 737  Macrophomina ...
CBX92521      666 VNLNA-KDHMSPLIITFAFSESEGNVGEPLQSQMTITSNARQGSAPVTLSSLSYHFSGALSEVQLSHERdE----KTAVT 740  Leptosphaeria...
ERT01127      748 KTTHSTIHLEEEdeddpgagtkTINGGDDDDET--RVLGLHGSANLTLQPQSTLVFELAIPLRQPGDAHAVSADLVYRCP 825  Sporothrix sc...
XP_012738833  214 NTSFTKVALREEhgn----sedTAMSVGKERGL--RFSTLVGDESLIFLPGQTRVFELSCPLREPGKAKAISATFALAAP 287  Pseudogymnoas...
CCE35055      695 KTQLAEIILEEA------------FTKSDSGSD--VASQFSGACDLTLAAGQTRVLEMAIPLREPGEAGVSSVGMHYESE 760  Claviceps pur...
EFY90525      679 SSFITKVALEEQ-------------FSTDGPGD----LPLSGICDLTLKPGEKRVFEMAIPLRESGEAEASTVVATYEHK 741  Metarhizium a...
CCD34406      716 GVLFKKTSLVDE----------STVEKGHDPDDppTRHTLTNYEDLTLSPGQVKAFEFVNLLREAGDAKALKVTFSIASE 785  Botrytis cine...
XP_007293914  709 VVALQSVPLTEA--------------------TpdERSVLIGHASLVFGPGQTRIFEFSTVLREDGEAKAISATFSMATD 768  Marssonina br...
XP_008080394  704 RV-FSEISLAET--------------------VenTRSNQSGEADLCFAPGQSKVYEFQTPLRDDGEVKATSVTFSMNTE 762  Glarea lozoye...
XP_007776772  746 RFSMVEVDLQEN----------------IDSAIskIPSRLAGNADLTFYPGQTKVFVFAINFKEAGDVGAVDSTFIVEAE 809  Coniosporium ...
EKG17579      738 NSPITELDLTEA---------------EEQTSA--TVPSFKGDADLTLSAGEVRVFVFPVVFKEAGEVFVENASFEIETS 800  Macrophomina ...
CBX92521      741 TSRMLACTLEET-----------------STSG--QKPQWAGVSDLTIYPGQTNVYTFPLIFREAGDVDADSCVFEVNTD 801  Leptosphaeria...
ERT01127      826 LYSLQmklplasYV-AGEGSRGRTPTWFLPRAGGRVSVPRADSQA--IKILPRPPKLDIQLlhapvataaatPIPTVQYY 902  Sporothrix sc...
XP_012738833  288 LFDLE-------CI-IEFDHITTRDMWW-SQKPARKRVVRADPHS--ITILPKPPKMEIKF-----------QALKDQYY 345  Pseudogymnoas...
CCE35055      761 AFDLQ-------HT-RVFKETDPVTGWY-VRGDDKPHALRAHART--LRIHPRPPKLQMTL-----------LDPSTQFY 818  Claviceps pur...
EFY90525      742 SFDIQ-------YT-MSFRDTDQVTGWY-IKTSDRPRQLRPDARI--LHIKPRPPKLLVSL-----------PESSGLYY 799  Metarhizium a...
CCD34406      786 LFDFD-------YV-HSFDRPSFPEMWY-GEHATKKKIVRARPSS--IHVLPKPPKLELRI-----------LEFQEQYY 843  Botrytis cine...
XP_007293914  769 HFDLE-------YV-NTFDQKIAPDVWW-GETSIKKRVVRLDATA--ITILPKPPKIQLRI-----------VGMQEQYY 826  Marssonina br...
XP_008080394  763 NFDLE-------YV-HAFEQTTLADIWW-GEKGMQKKIARPDTST--LRVLPKPPKMELRF-----------RGLQGQYY 820  Glarea lozoye...
XP_007776772  810 RFVLT-------YTsAVEGPETMPVWWYTARNLLKTKRLRAAAAAs-TKILPKPPKMQIFL-----------PNLQKAYY 870  Coniosporium ...
EKG17579      801 RFHLA-------CTsEAPQENTSPFWWYLTTTGLKTKRLGRIMDDpaIKVLPKPPKMEVRL-----------PNLQKRYY 862  Macrophomina ...
CBX92521      802 HFNLT-------CSdTDLHSSPNPAWWVTSNGAVKPRKYKGAGGLs-VHILPKPPKVEIRL-----------PDVRTQYF 862  Leptosphaeria...
ERT01127      903 TNEAIDLALELVNAEDADASVKLDVIMeggsdeagaSGSSTPGFTLLVaGDEIDTAEPQttdiasptpptAMLRSVP--- 979  Sporothrix sc...
XP_012738833  346 TNEPIDLNVDIFNGEDEESLASLEVTIsn-----dgVGTPQLPFKIIIpTAPESNVEYTpd--------dETPPSAK--- 409  Pseudogymnoas...
CCE35055      819 TDETIRIDVEMRNDEDEAALVKLGTQL---------KGEAVPSFTLQV--GEEEVAGTAaevde-ediqaRSAAVFT--- 883  Claviceps pur...
EFY90525      800 TNETVELGVELRNEEEEPAHVKLDVQL---------YGKSVPSLKLLV--GEHERNGETge-------eaTKALGVP--- 858  Metarhizium a...
CCD34406      844 TNELIYLNLEVKNGEETDSIVDLEARL---------LGENIPSNIVLRrLDKTDSPSDTese------edDHELS----- 903  Botrytis cine...
XP_007293914  827 TNEQIVLKVEVTNGEDVESIVNLEVRL---------VGDDVPTVTLKL--DDKENNEITele------sgNQLAGTP--- 886  Marssonina br...
XP_008080394  821 TSEGISLELEVLNAEDVDAITNLEVYL---------RGEDAPPIEIRA--SEALSAPEEqde------veKSLEGTP--- 880  Glarea lozoye...
XP_007776772  871 TDELVTLDIEIFNGEEEETEAVLEVRF---------FGRVESTLAFSWkIMEEAEQGNGsaeq---adnaNSEIDLPghq 938  Coniosporium ...
EKG17579      863 ATEPVVLELEVENGEDEETEAGLEFIL---------MDDQRKELEFSW-LSSPDAGATSd----------DKSANLPghf 922  Macrophomina ...
CBX92521      863 TDEPVTLAIEILNQEEEDTEAVLEVRL---------LGRQQDALGFAW----LERPASSpmkevppqvdgFKDVDLPghv 929  Leptosphaeria...
ERT01127      980 LGHVKAGHSVAIAIRIPPTTPSMDLDLTLRAAYHLVSDTATPITQQLSVKLSLSNPFEANYDLLPRMHPAAWPSLFDHEG 1059 Sporothrix sc...
XP_012738833  410 LGSISSSNTISAIVVLGPILIQSTYEITLQLKYNLASDLETPITRTAAIRFNIGSPFEANYDFSPRLDSRSWPSFFDPKD 489  Pseudogymnoas...
CCE35055      884 MGAIASGATAKFRLTISSTSTSSTLDLLLRATYHLESDAATTILQVLSVPLNIVGPFEANYDLVPRLHPDPWPSLFDCDG 963  Claviceps pur...
EFY90525      859 IGVISSGAAAELKLIIDPTTAPTTYDLHIQATYHLESDTATPIIQVLSLSLDLVGPFEANYDLLPRLRPEPWPSLFDYEG 938  Metarhizium a...
CCD34406      904 LGTIASGSSITVEMVISSIDLPAVYDLSLKASYNLVTDLETPISQAMSAQLSILNPFEANYDFSPRIHPGSWPSFFTHDE 983  Botrytis cine...
XP_007293914  887 IGRIASTAATIVDVVIPALDLPAVYDLSLKAAYNLVTDLETPVYQSMATQLEVINPFEANYDFSPRIHPDPWPSLFTHEE 966  Marssonina br...
XP_008080394  881 LGRIASSASSVVHIIIPPIDLPYVYELAVKASYNLVSDLETPVSRSITMQLEVINPFEANYDFSPRIHPDSWPSFFTHED 960  Glarea lozoye...
XP_007776772  939 VGKISSAARCTQSITFRTPPDPAEYTLEIKVLYHLITDLETPISKTLTTDFFFADPWEAAYDFSPRVHPDLWPSFFHVDE 1018 Coniosporium ...
EKG17579      923 IGKLESGAKRTHAVHFIAPIDSGELLFEAKVVYHTIGEPDVPISKTIVGELAIIDPFEATYDFTPQVHPDPWPSFFLVDD 1002 Macrophomina ...
CBX92521      930 VGKLSQGASTVEKIHFTAPPDPADFALEVKVLYHLLSDRDIPISKIMVADLVFNAPFEASYDLNARVHPEPWPSYFELRD 1009 Leptosphaeria...
ERT01127     1060 IVAtgtpEDAD---AVNRgfHGLTQAWALVTRYASFATEDLRVVDLDLVIQPEPRiSVQHTRTdaashngNDnGTPQtrd 1136 Sporothrix sc...
XP_012738833  490 GKT------SS---TGEVaaLGLPQKWNLTARYCSFAGEALIVEDVSLAILSLNG-GVACSGI-------HPlPNTSlg- 551  Pseudogymnoas...
CCE35055      964 IPIps-tADDE---ATAVrpKGLAQQWCLLCHYASFASEDLVVVGMETQVVSCTG-AVQCHVL----------PRPEegt 1028 Claviceps pur...
EFY90525      939 LHLv---TENE---AAAPpaKGFAQQWCLVCHYASFAMEDLTVLGVELQVVSCTG-GARCTVT----------RRTEvas 1001 Metarhizium a...
CCD34406      984 SLEi--sQDGQ---DNDReaFGLAQKWCLTTRFASFATEDVIVEDVDVEILGLQG-AIKCSTK----------RLTAipe 1047 Botrytis cine...
XP_007293914  967 VEA-----ATD---PQEVkaQGLAQKWCLTARYASFARDELIVNDVDVEVLGSNG-GIQCYTK----------KLTSips 1027 Marssonina br...
XP_008080394  961 STD----ADGS------EvaRGLAQKWCLTARYASFATEDLLVEDIDVEVIGMNG-GIQSSTK----------RISPlse 1019 Glarea lozoye...
XP_007776772 1019 KQSleapAEASidtA-----VGIAQIWLATARLENFAEEDLVVEDLSLVLQAVNG-GAICAISkespa------------ 1080 Coniosporium ...
EKG17579     1003 AQVpegsTDAA---ATKA--FGLTARYLMNVRIGSYAEEDLIIQDAELSVHEVAG-GAVARVSk------KPvEEPEv-- 1068 Macrophomina ...
CBX92521     1010 AESnfnpESAD---A-----FGIAQKWGLRAKVASFADEQLTVSDLAVKVHGVHG-GATCDVTkef--eaGEq------- 1071 Leptosphaeria...
ERT01127     1137 ad-----galtIKPQTMEESRFDLVVQKASLDDRDPVQLDVSFVITWQRLAPPGSPAGsagsvaplPTNTTTLPVPQLSL 1211 Sporothrix sc...
XP_012738833  552 ---------lpILPEALAESHFDVLTQKLSLDGRRSASLDLSLLIQWRRDVPES------------PSNTSTLPIPRLLV 610  Pseudogymnoas...
CCE35055     1029 kgddssdnnitVSPKTMYEAQFHLVAQKLSLDDRQPVTLDLAFIIKWRRQRKTAAAAAaeps-pedEVNTTLMPVGQYLV 1107 Claviceps pur...
EFY90525     1002 d-------gitISPQTIHEAQFDLVAQKFSLDDRHPVTLDLAFVIKWKRKTASVDS----------QTSATTMPVGQYLV 1064 Metarhizium a...
CCD34406     1048 g-------gikISPNELEEAQFDAFTQKYSLDDRGTATVDLSLVIKWRRNKDGS------------TINTCIVPVPRLLV 1108 Botrytis cine...
XP_007293914 1028 t-------glrVSPKSLDEAQFDTFTQKISLDDRGTATLDVSLAIKWRRSNRDSTSAS--------PINTTILAVPRLLV 1092 Marssonina br...
XP_008080394 1020 g-------gikVTPRTLEEAQFDAFTQKLSLDDRGTATLDVTLLIKWRRDVKDS------------PLNISKLAVPRLLV 1080 Glarea lozoye...
XP_007776772 1081 ------ntdtvIPQQELREYNFSLEVRKLTLEDRRPVSLDLHLDIKWRRKTGG-------------ASITSSKPCPRFVV 1141 Coniosporium ...
EKG17579     1069 ----------eIAPQAVQLRTFCVDVQKIALEDRRSSALATSISVTWRRKQPMSPHAEa------sSNVRSVIANPRLIA 1132 Macrophomina ...
CBX92521     1072 ----------aMDPQILSEWAFSLDVRKNNLEERRSTALDTTLNITWQRTSIPNA-----------PVVTSCLPIPRIQI 1130 Leptosphaeria...
ERT01127     1212 FGTEPRVLASVAYSr-----pSAPVPAIQLTLAIENASNHFLTFGVSMEPSADFAFSGAKLTTIHVLPMSRRATSYRLVP 1286 Sporothrix sc...
XP_012738833  611 ASSEPRVLTKLSYSe-----nTTQPMVLHMEYMIENPSMHFLTFSVVMEPNDKFAFSGAKQSTIQLLPLSRRGMSFNLLP 685  Pseudogymnoas...
CCE35055     1108 LGSEPRVLATATMDpl---saTASSRLLHLDLTIENPSSHFLTFGLTMDPSDSFGFSGPKHTTVHLLPVSRRSIRYRLLP 1184 Claviceps pur...
EFY90525     1065 LGTEPRVLASALYSn-----pTASTNLLHLDITIENPSNHFLTFGLSMEPSDTFGFSGAKQTTINLLPMSRRTARYRLLP 1139 Metarhizium a...
CCD34406     1109 SSSEPRVLAAVTYS-------STIPSMIHFDVTIENPSHHFLSFAITMDPSEQFAFSGVKQSTLQLVPLSRRTVKFRLLP 1181 Botrytis cine...
XP_007293914 1093 SSSEPRVLAAVSYS-------NKIASMIHFDVTIENPSNHFLTFGLTMEPSEKFAFSGTKQSTLQLVPLSRRTVGFRLLP 1165 Marssonina br...
XP_008080394 1081 SSSEPRVLAAVSYS-------ATISSMIHFDVTIENPSNHFLTFGLTMEPNEKFAFSGMKQSTLQLVPLSRRTVRFRLLP 1153 Glarea lozoye...
XP_007776772 1142 PSSEPRVLCTATQSpptatatSQTPPLITLSYTLENPTMHFLAFELTMEASEEFAFSGPKAGAVQLLPMSRQDVKFRILP 1221 Coniosporium ...
EKG17579     1133 ANSEPRVLASARPS-------SAVPSLIHLDYTLENPTMHFLTFDVTMEASEEFAFAGPKLTALHLLPHSRQTVRYNVLP 1205 Macrophomina ...
CBX92521     1131 PSSEPRVLASVQYS-------TSVASLVHLDYTLENPTMHFLTFEVNMEASEEFGFSGPKLRTLHLLPMSRQTVCYSLLP 1203 Leptosphaeria...
ERT01127     1287 LVRGAWIRP-ALVVRDKYFQKVLRILPTEGMKMDKDGILIWVP 1328 Sporothrix schenckii ATCC 58251
XP_012738833  686 NVRGEWVRP-QLVVTDRYFQKVLKVAPGDGMKSDKEGILIWIP 727  Pseudogymnoascus destructans 20631-21
CCE35055     1185 FVSGDYVRP-GIVVRDKYFQKVLRIIPTEAMKIDKDGLLVWVP 1226 Claviceps purpurea 20.1
EFY90525     1140 FVQGDYIRP-GLVVRDKYFQKVLRIIPTEGMKIDKDGLLVWVP 1181 Metarhizium acridum CQMa 102
CCD34406     1182 TVRGEWIGPiRCVIRDRYFQKVLKIAPTEGMKSDKEGLLIWVP 1224 Botrytis cinerea T4
XP_007293914 1166 TVRGEWVGPiQCVIRDRYFQKVLRIAPTEGMKSEKEGLLVWVP 1208 Marssonina brunnea f. sp. 'multigermtubi' MB_m1
XP_008080394 1154 AIRGDWIGPiNCVIKDRYFQKTLKIAPTEGMKMDKEGILIWVP 1196 Glarea lozoyensis ATCC 20868
XP_007776772 1222 LVRGAWISP-QLRVVDRYFGKVLKVLPTEGLRADKGAVGVWVD 1263 Coniosporium apollinis CBS 100218
EKG17579     1206 LVKGAWIYP-QLKVQDRYFNKILKPAPTEGMRQDKKGVAVWAD 1247 Macrophomina phaseolina MS6
CBX92521     1204 LVTATWITP-HLKVMDRYFNKTLKVQATEGLRMEKKGVGVWIP 1245 Leptosphaeria maculans JN3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap