Conserved Protein Domain Family
DUF1679

?
pfam07914: DUF1679 
Protein of unknown function (DUF1679)
The region featured in this family is found in a number of C. elegans proteins, in one case as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in ZnF_C4 and HLH domain-containing kinases. In fact, one member of this family is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (Interpro:IPR000536, Interpro:IPR008946, and Interpro:IPR001628).
Statistics
?
PSSM-Id: 369592
View PSSM: pfam07914
Aligned: 20 rows
Threshold Bit Score: 462.902
Threshold Setting Gi: 74964700
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9U368        10 ILDNGDGLFQTHVQLDDVQDVIGEQMNTEARLGKNTKYTVVGDGNGFMSRVILVEPEWT----VPDEHLPEKFILKITSC 85  Caenorhabditis ...
Q9XUP2         8 ILDNGEGLFQTHVYVKDVQEAIGEQMNTESRLGENTKYTVVGDGNGFMSRVVLVEPEWT----ITENHLPKKFILKICSS 83  Caenorhabditis ...
Q9XUP7         7 LIQNGDGLFQTHVQLEDVQELIRDQMNTEARLGEKTKYTVVGDGNGFMSRVILVEPEWT----ITDENLPKKFILKITSC 82  Caenorhabditis ...
Q9XUP8         8 IIDNGDGLFETHVKLEDIQILIKEQMNTDSKLGEKTKLTVVGDGNGFMSRVVLVEADWT----IPNENLPEKIILKLTSC 83  Caenorhabditis ...
O61882         8 ILQPGTGLFNTHVTLEDVNKAIKEQMSTESELTAESKMEVIGEGNGFSSCVILITCHWT----IPSSHLPKKLILKIVSF 83  Caenorhabditis ...
Q8IA57         8 ILQPGTGLFNTHVTLFDVNKAIKEQMSTESELTAESKMEVIGDGNGFSSRVLLISCNWT----IPSAHLPKKLILKIVSF 83  Caenorhabditis ...
XP_002647572   9 ILEDGNGLFGTHVTLKDVNDAIREQMDTDLELTPKSKMTVIGDGNGFSSCVILISCKWN----KPSDTLPHKIVLKVVSF 84  Caenorhabditis ...
CAP22676      35 ILEDGNGLFSTHVALDDVNFAIKNEMRTESELSKDSLLEIIGDGNGFSSCVILVTCDWS----IPSIDLPKKLVLKIVSF 110 Caenorhabditis ...
CAP30453       3 LYEPADGLLGTHVTWHDVEMEMQRVLGTNARFGANRQIRDIGDMKGFMSKIAMIQADWNfpsqEDFRNLPDRIAVKMSSE 82  Caenorhabditis ...
Q20974         3 LYTVADGLLGTHVTWEDVLEEMQKALDTTATFGDDKTATNISDMKGFMSKIALVEPKWVg--aSENEELPEKFVVKISSQ 80  Caenorhabditis ...
Q9U368        86 LHVHGLVEKMKgkspGAFPAEQEaalWAIFENEAQQLHNREVNLYKITEKWnkNETMLSPKIYFYKKFDAENKTKGILGM 165 Caenorhabditis ...
Q9XUP2        84 LHVHGIVDKMKesnqSI--NENEeelWAMFENEAQHLHNREVNFYVLAEKWnkPEELLNAKIFFSKKFDSENKLKGFLGM 161 Caenorhabditis ...
Q9XUP7        83 LHVVGLLEKLKeseqNVINDANEadlMALFENESRLFHNREVNLYKITKKWnkNDELLSPKIYFYKKFDSENQTKGILGM 162 Caenorhabditis ...
Q9XUP8        84 INVHHLVSQMKeknpDAFTEQQEaelWAMFEREAQNVHNREVNLYRITEKWnkNDALLSPKIYFYKKFDCENKTQGVLGM 163 Caenorhabditis ...
O61882        84 VHVQGLLNKSNeegnSVMSPEEEahvHAHFEKSCQKGHNLEVEFCEAFGHLe---GLLLPKVFFSQKFEEDNPNKGFVGM 160 Caenorhabditis ...
Q8IA57        84 VHIQALIDKGKqqnaSLITKEVEeqmYAYFESSCKKMHNQEMNFYEVAGKFn-SKTLLIPKVYFYTKLDEKNSNKGFIGM 162 Caenorhabditis ...
XP_002647572  85 SHIKALISKAEkegiFKKSENEKkdmNANFEISIQRIHNQEVDFYNVLKKGe-PENLLILKVYFTSKFDENNKTKGFIGM 163 Caenorhabditis ...
CAP22676     111 THIKRLIDNAKskgfCKVKSKDEekmAEHFLISILAMHNQEINFYEILSSAn-AENILTPKVYFSQKFDETNRCKGFIGM 189 Caenorhabditis ...
CAP30453      83 LSLYDFSTLVSs---EKWGVEK----MKSMTSHVKELHNREVHMYKILGREq--PDCPTVNVLALEEFTEYTPLKAYIIS 153 Caenorhabditis ...
Q20974        81 LPFIEMTKLMDfssgDEFWDDAK---LKGMGEVTRLLHNREVATYKILMREk-HPKIPFTKVYASKPFDDENKLKAYLIS 156 Caenorhabditis ...
Q9U368       166 EFVSDVTIRHLYCNAKPYELHPVLRSLATLQAGSLHLT---EDEINSIsgf--dfKQMMGAMMNEegMKNIYEQTREIN- 239 Caenorhabditis ...
Q9XUP2       162 EYVDDVTIRHLYCNLKPYELHPVLKAVAQLQAESLHLS---DEELQSIsgf--dfKQMMGTMFNDdgLKGNYKQTRDIN- 235 Caenorhabditis ...
Q9XUP7       163 EAVDDVTVRHLYYNVKPFELHSVLKSIARLQAESLHLT---DQEKQSIagf--dlKKMSNTIFSEegMQNNFKQTREIN- 236 Caenorhabditis ...
Q9XUP8       164 EYVDDAVVRHLYCNAKPHELHPILQSLATLQAGSLHLT---EDEINSIsgy--dfKSMVGRMMSEegMKQMYTRARQIN- 237 Caenorhabditis ...
O61882       161 EFVEGSVVRHCYENVTVDELQPILKALARLQALSLS-----TESCRNLdng-eafEESLMDMLSEdgLKGIFDQSRNID- 233 Caenorhabditis ...
Q8IA57       163 EYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPaeiSKDLQKIdng-aifQETLKMMLSEsgIKGIFEQCRNLE- 240 Caenorhabditis ...
XP_002647572 164 EYIEGSETRHSYENCTVKEIQPVLKAIAHIQALTVSTP---EEEIEKTfnd-ssyTESMKSMMEGdrMTGIFMHTKNQN- 238 Caenorhabditis ...
CAP22676     190 EFLEGIGIRHSYENCTVQEFQPILKLIASIQALSFSVP---NEDFKRIede-svyAKSVEAMMSGegMKGCFEHTRLRD- 264 Caenorhabditis ...
CAP30453     154 EYIPNLHDVAMSDNVPLEDIWAVVDGIAAFSAMGESMS---DEEIKTAtngygyiADAIEHFYGEhsPDNMRQNLIDVLg 230 Caenorhabditis ...
Q20974       157 EYYPNIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLS---EEETKYArga-dflDIVFGQFMDEksIERMNVLLKASFp 232 Caenorhabditis ...
Q9U368       240 ---PERLTEKTNTVEAFGLEVVNFELSCNLNKYVGIeRDVLVHGDLWAANILWKEENDgkfsVSKVIDYQLIHMGNPAED 316 Caenorhabditis ...
Q9XUP2       236 ---PERLKEKTDIVEAFGMEVVNFEFAGNLNKVVGIhKDVLVHGDLWAANILWNE-NDgkfsASKVIDYQIIHMGNPAED 311 Caenorhabditis ...
Q9XUP7       237 ---PERLKESVDKVEIYGTELVDLDKAINLNSYIGIeRDVLVHGDLWSANILWEE-NEgkflVSKVIDYQLIHMGNPAED 312 Caenorhabditis ...
Q9XUP8       238 ---PERLTKPTDAVEALGMDIVNFEISCHVNKYAGIqKNVLVHGDLWAANILWKE-NDgncvASKVIDYQLIHMGNPAED 313 Caenorhabditis ...
O61882       234 ----QKLSEKVERIEQNHKEILNLETVLNLNKVVGIdQKVICHGDLWAANILWTQ-TDggfiADKVLDYQESHMGNPAED 308 Caenorhabditis ...
Q8IA57       241 ---RSRFGEKVDRIEEKRNEILDFEKAFNLNKVVGIkQNVLCHGDLWAANFLWTE-NNgvfcATRIVDYQMSHLGNPAED 316 Caenorhabditis ...
XP_002647572 239 ---PERFGELVASVERLAPGILDFEKACNLNKYIGInKNVFVHGDLWSANILFAPGKDasmyVSKVLDYQLAHMGNPAED 315 Caenorhabditis ...
CAP22676     265 ---TEQFTDIVERIQGYGTKILDFKKAFNLNKVLGYyQKRLRSRGPLEANILWTKESNgqftALKVIDYQTAHTGNPAED 341 Caenorhabditis ...
CAP30453     231 vafEEKVDEAMDIFEMICGSPEIQNNYSKVSQYLGH-FPVLMHSDIWPSNLLFSRSSQghleFKALIDFQTASMSSPGLD 309 Caenorhabditis ...
Q20974       233 eeyLEKVEEMLKIYKDYYFQPQMIKNFKNTCQFFGY-KPVLTHSDLWSSNFLCTRDGEkv-tLKAIIDFQTVSITTPAQD 310 Caenorhabditis ...
Q9U368       317 LVRVFLSTLSGADRQAHWERLLEQFYEYFLEALGDD-KPPYSLEQLKESYRCYFVSGGLVMMPMYGPIAQVKlsySNDTE 395 Caenorhabditis ...
Q9XUP2       312 LVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDN-EIPYTLDQLKESYRLYFVTGSLVMLPLYGPIAQTKlsySKDTE 390 Caenorhabditis ...
Q9XUP7       313 LVRLLLCTLSGADRQAHWERLLEQFYEYFLEALQDN-ETPYSLEQLKESYRQYFVTAGLFMLPMFGPIAQMKlsySSDNE 391 Caenorhabditis ...
Q9XUP8       314 LVRVFLSTLSGADRQAHWEKLLEQFYEYFLEALEGN-EAPYTLDQLKESYRLYFVGGGLFVMPLFGPVAQAKlsySTDNE 392 Caenorhabditis ...
O61882       309 LVRLLVSTISGADRQSHWEHILEQFYTYFTDEIGSN-NAPYTLEQLKTSFKLYFPVGALTLISLFGPAVDMKl-qGMESG 386 Caenorhabditis ...
Q8IA57       317 LVRLLVSTITGADRQAHWQQILEQFYSYFLNELGSG-EAPYTLEQLKLSFKLYFPVGALALLPLFGPAVDAKl-eGMDSE 394 Caenorhabditis ...
XP_002647572 316 LVRFLCSTLSGSERRQNWERLLEDFYAYFLEAM-QTrEIPYTLEQLKLSYRSYFPMGGLALLPLLGPAVDVKi-kSMSEQ 393 Caenorhabditis ...
CAP22676     342 LVRFLTSTLSGSDRQAHWEQILETFYEYFLEALGEN-KAPYSSEELKKSYKLFFPMGGLALLPLFGAAVDMKl-eSMDKD 419 Caenorhabditis ...
CAP30453     310 VACLMVTCLSKTDRRACKAELLDRYYASFVKSLKPHqSIPYTRKQLEDSYDLCFPAAIILMLPFIL---------SFSLR 380 Caenorhabditis ...
Q20974       311 VGRLFASCLSTKDRREKADFLLEEYYNTFVNEL-DGmDVPYTFQQLKDSYQVYFPLMTTMVLPGIAPMLQHS---NVTEE 386 Caenorhabditis ...
Q9U368       396 SVEEYREILTEKAEHLMEDLERWHLYSK 423 Caenorhabditis elegans
Q9XUP2       391 HVEEYREILTEKAEKLLEDMEHWHFYSR 418 Caenorhabditis elegans
Q9XUP7       392 HAEEYREVLTEKAERLMEDLERWHLHSK 419 Caenorhabditis elegans
Q9XUP8       393 NVEEYREVLTEKAERLMEDLKRWHLYSK 420 Caenorhabditis elegans
O61882       387 KAENYRRIVIEKVDCLLDDVLNFHDFNK 414 Caenorhabditis elegans
Q8IA57       395 KAEKCRHVVIEKVACLLDDLEKYHKFSK 422 Caenorhabditis elegans
XP_002647572 394 TAEKYQKVLAEKIECLLEDVEKFYLETI 421 Caenorhabditis briggsae
CAP22676     420 ETEKYKNIVIEKLKCLLEDVEKFYLESS 447 Caenorhabditis briggsae
CAP30453     381 LGDVIPENSIDKSAGLIEDLIAVHKSNL 408 Caenorhabditis briggsae
Q20974       387 YKDSMKQVALDKMIGLLEDVITTHESNI 414 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap