Conserved Protein Domain Family
Gp58

?
pfam07902: Gp58 
gp58-like protein
Sequences found in this family are derived from a number of bacteriophage and prophage proteins. They are similar to gp58, a minor structural protein of Lactococcus delbrueckii bacteriophage LL-H.
Statistics
?
PSSM-Id: 369586
View PSSM: pfam07902
Aligned: 7 rows
Threshold Bit Score: 708.645
Threshold Setting Gi: 81533555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAM30818       1 MSRDPTLLIDESNLTIgSDGRAYYTFKADGDTKSVKLANNkCIGTTRFNQLMIERGGKPTNYVAPVVVegSGESTGLFKN 80  Streptococcus p...
Q99Z20         1 MSRDPTYTINEHDLSF-ADGRFYVTFKADKSSETVRLNSS-CLGNTIIKKLQVEDDNTMHDFVKPKVT--TQQAFGLAQQ 76  Streptococcus p...
ABL61073       1 MSRDPTLTLDESNLTIgSDGRVHYTFTASQDNQKVRLASN-CLGTTRFNQVMIERGDKATDYVAPVVVegSGESTGVFKS 79  Streptococcus p...
Q1CQP9         1 MSRDPTLTLDESNLVIgKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVegSGESTGVFKS 79  Streptococcus p...
Q99ZZ6         1 MSRDPTLTLDESNLVIgKDGRVHYTFTASQDNQTVRLASN-CLGTAHFNQLMIERGDKATGYVAPVVVegSGELTGVFKS 79  Streptococcus p...
Q48T72         1 MSRDPTLLIDESNLTIgSDGRAYYTFTADGDTKSVKIANNkCIGTTRFNQLMIERGGKPTNYVAPVVVegTGNPTGLFKD 80  Streptococcus p...
YP_001039937   1 MSRDPTLLIDESNLTIgSDGRAYYTFTADGDTKSVKIANGkCIGTTRFSQLMIERGNKPTSYVAPVVVegSGESTGLFKN 80  Streptococcus p...
BAM30818      81 legalsqLKELNLELTDTVnSQLWAKIKLTTNGMLREYHRDNITTEIVESANGIATRISedtdkklalin---------- 150 Streptococcus p...
Q99Z20        77 -------VKELDLQLKDPK-SDLWGKIKFNNKAMLVEYANKEMSSAIAQSAEQILLQVK--------------------- 127 Streptococcus p...
ABL61073      80 leemlsgLQSINLELTDTKnSNLWSKIKLTTNGMLREYHRDHIKTEIVESADGIAKRIAddtgqklalin---------- 149 Streptococcus p...
Q1CQP9        80 leemlsgLQSINLELTDTKnSNLWSKIKLTTNGMLREYHRDNITTEIIEKADGIATRISedsdkklalin---------- 149 Streptococcus p...
Q99ZZ6        80 leemlssLRSINLELTDTKdSKLWSKIKLTNRGMLQEYYDGKIKTEIVNSAQGVATRITeetgkklalin---------- 149 Streptococcus p...
Q48T72        81 -------LKEISLELTDTKnSKLWSKIKLNNQGMIEEYYNGTIKSEIIKTAEGTQQRISsetdkklalin---------- 143 Streptococcus p...
YP_001039937  81 legalsqLKELNLELTDTEkSNLWAKIKLNNRGMLQTYFDTTIKNEILTTARGIKETISdterglqseflktvqgqriql 160 Streptococcus p...
BAM30818     151 ---------------------------------etvsgirrdyqDADRQLSSTYQAGINGLKATMANDKndlkavIQATA 197 Streptococcus p...
Q99Z20       128 --------------------------------------------SIDDERYSKFEQTLNGIKQTVKSES------VESAR 157 Streptococcus p...
ABL61073     150 ---------------------------------etikgikreyqDADRQLSASYQAGIDGLKTQLANDKiglqaeIKLSA 196 Streptococcus p...
Q1CQP9       150 ---------------------------------dtidgirreyqDADRELSASYQAGIEGLKATMASDKlglqaeIKMSA 196 Streptococcus p...
Q99ZZ6       150 ---------------------------------esingirreyqNADKKLSASYQLGIDGLKATMRSDKiglqaeIQTTA 196 Streptococcus p...
Q48T72       144 ---------------------------------etvsgirreyqDADRQLSSSYQAGIEGLKATMANDKiglqaeIQTTA 190 Streptococcus p...
YP_001039937 161 eslleqktaqlgltvdglrldlnradkqtaslqasieglrqdyqDADRQLSSTYQAGIEGLKAQLTNDKlglraeIQASA 240 Streptococcus p...
BAM30818     198 QGLSQKYDDEIQQLSAKITTTSSgTTEAYESKLADLRAEFTRSHQgmrtvlesRISGlqstqqstayqISQEIKNREGAV 277 Streptococcus p...
Q99Z20       158 TQLASMFDSRISGLDGKYSRLSQ-TIDSLSSRLDDGVGNYSTLSQ--------KVSG-----------IDLRVSNAANDV 217 Streptococcus p...
ABL61073     197 QGLSQKYDDELRKLYAKITTTSSgTTEAYENKLEGLRAEFTRSNQgmrtelesQISGlrsvqqstakqISQEIRDRTGAV 276 Streptococcus p...
Q1CQP9       197 RGLSQKYDDEIRKLSAKITTTSSgTTEAYENKLEGLRAEFTRSNQgmrielesQISGlravqqstasqISQEIRDRTGAV 276 Streptococcus p...
Q99ZZ6       197 QGLYQRYDNEIRKLSAKITTTSSgTTEAYESKLDGLRAEFTHSNQgmrvelesKISGlqstqqatarqISQEISNREGAV 276 Streptococcus p...
Q48T72       191 QGLYQRYDNEIRKLSAKITTTSSgTTEAYESKLDGLRAEFTHSNQgmrvelesKISGlqstqqatarqISQEISNREGAV 270 Streptococcus p...
YP_001039937 241 QGLSQRYDNELKQLSAKITTTSSgTTEAYENKLNDLRAEFTRSNQgmrtvlesKISGlqstqqstayqISQEIKNREGAV 320 Streptococcus p...
BAM30818     278 SRVQQDLASYQRRLQDTEKNYSSLTQTVRGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-KG 356 Streptococcus p...
Q99Z20       218 SRLSQTAQGLQSQITNANQNYSSLSQTVQGLQTTVRDNQSNATSRINQLSDLISTKVSKGDVETTIAQSYDKIAFAI-RD 296 Streptococcus p...
ABL61073     277 SRVQQDLASYQRRLQDAEKNYSSLTQTVKGLQSTVSDPSGKIQSRFTQLQNQIDQRVTRDDVMSIINLSGDSIKLAIqKA 356 Streptococcus p...
Q1CQP9       277 SRVQQDLDSYQRRLQDAEDNYSSLTHTVRGLQSDVVSPTGKIQSRLTQLAGQIEQRVTRDGVMSIISGAGDSIKLAIqKA 356 Streptococcus p...
Q99ZZ6       277 SRVQQGLDSYQRRLQSAEGNYNSLRETVAGYERRISNQDNTISSNFTQLKSLINQSVTLGKIQSLLRQSGDSIMLAIkDK 356 Streptococcus p...
Q48T72       271 SRVQQGLDSYQRRLQNAEGSYSSLQQTVSGLQSDVNSPNSKLNSRISQLASQIDQRVTRADVTSIINQSGDSIKLAIqRA 350 Streptococcus p...
YP_001039937 321 SRVQQDLDSYQRRLQDTEKNYSSLTQTVKGLQSTVSAPNRGLESRVTQLAGLIEQKVTRGEMESYIRGAGDSIMLAI-KG 399 Streptococcus p...
BAM30818     357 KLPQSKMSASEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLKADQIIGGTIDANKINVINLNASSIV 434 Streptococcus p...
Q99Z20       297 KLPASKMSGSEIISAINLDRSGVKITGKNITLDGNSYISNAVikDAHIAN---MDAGKINTGYLNANRIATEAITGEKIK 373 Streptococcus p...
ABL61073     357 GGIDAKMSAKEIISAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLKADQIIGGTIDAAKIRVINLNASSIV 434 Streptococcus p...
Q1CQP9       357 GGINAKMSGNEIISAINLNSYGVTIAGKHIALDGNTTVNGTF--TTKIAEaikIRADQIIAGTIDAARIRVINLNASSIV 434 Streptococcus p...
Q99ZZ6       357 I-PQSKMSGSDIISAINLNSRGVQIAGKNIALDGNTTVNGAF--GAKLGEfikLRADQIIGGTIDANKINVINLKASSIV 433 Streptococcus p...
Q48T72       351 GGIDAKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKIGEfikLKADQIIGGTIDANKINVINLNASSIV 428 Streptococcus p...
YP_001039937 400 KLPQSKMSAKEIVSAINLNGYGVRISGERIALDGNTTVNGAF--GAKLGEfikLRADNIIGGTIDANKINVINLNASSIV 477 Streptococcus p...
BAM30818     435 -------GLDAN-------FIKARIEHTITSL------LEGKVIRARNGAMMIDLNNSTIDFNSDASINFNSNNNALVRK 494 Streptococcus p...
Q99Z20       374 mdyaffnKLTANegyfrtlFAKDIFATSVQSVtlsaskITGGVLAATNGASQWDLNNANMTFNRDATINFNSKNNALVRK 453 Streptococcus p...
ABL61073     435 -------GLDAN-------FIRAKIEHTITSL------LEGKVIRARNGAMMIDLSNSKIDFNSNATINFNNKDNALVRK 494 Streptococcus p...
Q1CQP9       435 -------GLDAN-------FIKAKIGYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 486 Streptococcus p...
Q99ZZ6       434 -------GLDAN-------FIKARISYAITDL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 485 Streptococcus p...
Q48T72       429 -------GLDAN-------FIKARIEYAITSL------LEGKVIKARNGAMTIDLQSGQ--------INHYTNESAMRRI 480 Streptococcus p...
YP_001039937 478 -------GLDAN-------FIKAKIEYAITSL------LEGKVIRARNGAMLVDLNSAKMDFNSNAEIVFNNTSNILYRQ 537 Streptococcus p...
BAM30818     495 S-GTHTAFVHFGNATPK----NFTRSALYASIGITS------SGDGINSASSGRFCGARFFRTASGYEHTASVDQAEIYG 563 Streptococcus p...
Q99Z20       454 D-GTHTAFVHFSNATPK----GYRGSALYASIGITS------SGDGIDSASSGRFAGLRSFRYATGYNHTAAVDQTELYG 522 Streptococcus p...
ABL61073     495 D-GTHTAFVHFSNATPK----NYTSSALYASIGITS------SGDGINSASSGRFCGARFFRYARGYEHTALVDQAEIYG 563 Streptococcus p...
Q1CQP9       487 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 553 Streptococcus p...
Q99ZZ6       486 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 552 Streptococcus p...
Q48T72       481 DsSTASQFIKMTKSGFI----SEIGNMQAAMTVIGS------NSDGSENHENKTFGGIRIWNGKSSYQSTSFV---ELVG 547 Streptococcus p...
YP_001039937 538 KmINSYRYGNRNNIGALvfkdGYEGGVQVTLGVVSDktidqvKSGAVDWNDDGGYAGIRIRRIAP----YSDADGVEIIG 613 Streptococcus p...
BAM30818     564 DTIIFADDFGINRGFKMTPTGVNTLVDINkmyyaivalarcwkhlqnvgwdtthpnFT 621 Streptococcus pyogenes M1 476
Q99Z20       523 DNVLIADDFNINRGFKFRPDKMEKVLDMNdlyaavvalgrcwghlanvgwntahsnFT 580 Streptococcus pyogenes serotype M1
ABL61073     564 DDIVFSDDFNIDRGFKMRPSLMPKMVDLNkmyqail--------------algpllVT 607 Streptococcus phage P9
Q1CQP9       554 NRVAIYGNKN----------RSPWLFD-----------------------------ST 572 Streptococcus pyogenes MGAS9429
Q99ZZ6       553 NRVAIYGNKN----------RSPWLFD-----------------------------ST 571 Streptococcus pyogenes serotype M1
Q48T72       548 NRVAIYGNKN----------RSPWLFD-----------------------------ST 566 Streptococcus pyogenes serotype M28
YP_001039937 614 DRIIFRHTTKTHVAGTLYWQNTGWLGNWN---------------------------LG 644 Streptococcus phage phi3396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap