Conserved Protein Domain Family
DUF1670

?
pfam07900: DUF1670 
Protein of unknown function (DUF1670)
The hypothetical eukaryotic proteins found in this family are of unknown function.
Statistics
?
PSSM-Id: 369585
View PSSM: pfam07900
Aligned: 8 rows
Threshold Bit Score: 302.004
Threshold Setting Gi: 74529141
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004078828  30 DEYAFIGGdrVLNMITEDVIKTVKDYShdPWSLEVGQIMWFARSRFEKPgpAKSSADIKKVPVILSIVHEDDIKMKNDgf 109 Methanoplanus l...
Q8TH36        32 QDYSFPRA--VCRSLSELFISYIDLYF--SSQRKEGQIIFHGVSKDVPP--GVPVNEMNLVSVIITIYDPEDCKVKNQ-- 103 Methanosarcina ...
EHQ34539      30 EDYGFAAA--IARSLKDLFMSYFNTYL--GHEKSDGQMIYRVIPSDVPP--GIEVSKIKTLPVQLTLCDVSDIEIMNKs- 102 Methanoplanus l...
EHQ36500      46 EDYGFSKA--LSRSLVHLMREHIDENY--GNLRKDYQVVYHPVSANEPP--GKSLDELRKVSVSLTVFDTEDERVLREcg 119 Methanoplanus l...
Q8TKL1        22 YDFELAPG--VTRSILESVKYHFDPEYfhDNGLSKNRVPIDLVSSDEPA--GKPLIKCKLVTVWITLVSKTDLDVLSEyg 97  Methanosarcina ...
Q8TKL2        29 TEYRFLGGkrVVKMIVNDVKGLIDQFF--PDNLEVGQVIWPAVSVDESQeqHKKIEDHKIIPVRLNLVTREDMEKLEKkv 106 Methanosarcina ...
EHQ34540      25 KDYTMINGdkIKQMFAEDVVNLVREEFreLDSVETGQILWIGIHKDDKPsyGKNAGNIQMVPISLSLIAKEDLDMTAEgy 104 Methanoplanus l...
Q8TH45        20 NDYQFIAGdkIQEMFANDLVEVVRKSYrePWKLEVGQILWYGAKASEKPnyGKNSKKTPLTPIVLTLISKDDLEMKKEgy 99  Methanosarcina ...
WP_004078828 110 saKEVRVGRIVRIINEAYEQEAVLTQSDIALLLGICKATVSNLINEYqKKNKTTLKYCGMVLDIGPSLTHKKEIIRMFLQ 189 Methanoplanus l...
Q8TH36       104 --RELLDKRIMRISNEAHTQGALLTQADIAILLGESTKTISRHIEAL-EENGELVPTRGKWKDIGPGVSHKKRILELYLK 180 Methanosarcina ...
EHQ34539     103 -sVELQRHRIIRLTNEAYDQGGVLTQSDLSVMLGESLRTISTRVSEL-KKEGIIVPTRGNKKDIGPGVSHKVKIVELYLK 180 Methanoplanus l...
EHQ36500     120 -pSGLRKHRIVRLTNEAYDQGGLLVQEDLALLLTTSVRSIRRDIKEL-KEEGITIPTRGAIQDIGPTISHKTQIVELYLK 197 Methanoplanus l...
Q8TKL1        98 -vAALRKAKMLRYAEEAYDQDALFTHEDLASLLTVSERTIQRDVKEY-EAQGIVVPTRGYIKDIGSAVSHKTKAVKLLLQ 175 Methanosarcina ...
Q8TKL2       107 kkTEIEKARAVRLFNEAYEQGALLTQADVVVLLGKSIPTVSKYVQQYqNEHDEVLPTRGNIHDIGPGITHKGIIVRKKLE 186 Methanosarcina ...
EHQ34540     105 skQEIREKRIVRLFNEAYQQSALLSNTDVGMIIGVSPTTVSKQAREFmEREKVVLPTRGTIHDLGMATTHKKIIIRLYMD 184 Methanoplanus l...
Q8TH45       100 sdREIMETKVVRIFKEAYEQEALLTHSDMAYLLNVSTGTVSKQAKEYmQRTGEILPTRGIIHDIGRAVTHKRIILNLYIK 179 Methanosarcina ...
WP_004078828 190 NVPTPDISRRMNHTEDACDRYIKSFKKVQMLYNSKMEPTKISLLLEMSERLVVEYIEI 247 Methanoplanus limicola
Q8TH36       181 GYEYTEIERKTQHSGEAIMRYVKDFARILVLTEEGFEDEELRIITGLSEKTIQEYKEL 238 Methanosarcina acetivorans
EHQ34539     181 GYDFTEIKRRTRHSSEAISRYLNDFARVSCLDDMKHSMEEIRIITNHSENLVKQYLDL 238 Methanoplanus limicola DSM 2279
EHQ36500     198 GYEYTDIELRTHHTGDAIKRYIKAFSKVLFLHRSGYSPVEIRELTDLSEKVVSEYLEL 255 Methanoplanus limicola DSM 2279
Q8TKL1       176 GSQPSEVARRMHHSIRSIERYLQSFERVVYLNEKGLSNAEIRYSVGISERLVEEYMQL 233 Methanosarcina acetivorans
Q8TKL2       187 KKSTSQIAKETNHSPEAVDRYIRDYGRVKMLIGKRMTVEEISYATGISRGVVEQYREL 244 Methanosarcina acetivorans
EHQ34540     185 GHLTPAIARITNHSEEAVDRYIRAFEKVNLLKDE--KPEYIHSVTGMSNWLIKSYLDI 240 Methanoplanus limicola DSM 2279
Q8TH45       180 GYQTPDIARMTNHTQEACDRYIKAYKKVEKLSKT-MKSEEIAQILGMGKSLVEEYIRI 236 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap