Conserved Protein Domain Family
Frigida

?
pfam07899: Frigida 
Frigida-like protein
This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time.
Statistics
?
PSSM-Id: 400314
View PSSM: pfam07899
Aligned: 50 rows
Threshold Bit Score: 215.179
Threshold Setting Gi: 75218990
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002961449  155 AEVRVRPELKTLCENMDGEGLRRYVsehrkDVSALR--L--ELPVAIRCAIDPARLVLDALEGYSIPsdsesgGGGDRKE 230  Selaginella m...
O04650        835 qETIASSHLGNVDVLLDPEGSTSF--------------SpnEVFTGLQGMIDPASYVLNVVNDELLG------AQQRGEL 894  thale cress
XP_015629797  457 REPAPRRQLVAACERMDSFDMAELVlrsgrGIAG-------EFLPALRRAPDAPALALHAAGYVLSAgprdvdSTS---- 525  Japanese rice
Q10HH4        294 ALPSCSDHLRGVCAGMDVRGLLKLVck----nQSIClwH--EYPVVMRHAPDAAALVLQVVQGFLLS-----------KK 356  Japanese rice
XP_004252292   45 DSKSPDSQLETLCKTMCGKGLRSYIlsklpEKNTLR--E--ELTKALKLAPNAAKLVLSCMGDFFAKr-----GKAFDKD 115  tomato
XP_015169712  201 SSPRSSSEVKILCETMNSHGLRKYMirrlsCLKTLQ--Q--KVPKALKLSPNPARLILEAIGMFYTQg-----SNTYVEG 271  potato
XP_002511054  130 AKSSSSSELISLCEMMCGRGLRKYLtsnltNIPKLR--N--EVPTALKYAPKPAKLVFDCFGGFYLQg-----SRAYTKD 200  castor bean
KRH63904      103 EEEEEEDELLTLCKTMNSRGLRKYVltrlsETASLR--E--QVPLALRSAPNPSRLVFECIGRFFLQg-----SKAYTKD 173  soybean
XP_025879883  117 GGDPSAEHMGRICERMGSGELLRFVisrmgDLSWLL--R--AVPPALRRAPNPAELVLRAIGRYYIRpggrhtEA----- 187  Japanese rice
XP_004986116  164 DGDPSAAELELRCKQMNFRELRRFVtahvrDREWLR--K--VGPAALRRAEDPASLVLRAVGRYYISaesgdaEA----- 234  foxtail millet
XP_002961449  231 SGVSANRRACVLILESAGSALAdpvlgvehpVVPFNIKERAKELAGRWKSRMDVLkdssgavaSENSLDAQVFLQLLATY 310  Selaginella m...
O04650        895 GLAEPVIKTLIPLLEELPRVVK----------SSKHLLSDALQVATRWSwmmg-------nstQMSPLEAWGFLQLIVAY 957  thale cress
XP_015629797  526 ------WDNLAALLRGVRRLATsgr----aaPPLEARAKEATAMAKKWIAMVAGEaerehqrvAWARSATWALLQFVAAY 595  Japanese rice
Q10HH4        357 MKTTKVWGNCVGLIRCLPAVNA---------SLSSDTMKQAKQLAKDWKEMIDSTgs----srDVLNLSSWGLLYFLISY 423  Japanese rice
XP_004252292  116 ARMIATREASALVLECFLLIGFd--------VIDEGVKEEAAQAAVIWRRRFVDErg----irKASTMDARGLLLLIGCF 183  tomato
XP_015169712  272 SPLITERRALVLLLECFLRMIGegegegssvEIENGEKEEAGQAALAWYRRLNFEgg----ilKAQEIDARGLLLFIGCF 347  potato
XP_002511054  201 SPMVPGRKASILVLELFLLILDdg------iQFDSDLRQEAQQAAAAWRKRLIAEgg----vsKACEIDARGLLLFVGCF 270  castor bean
KRH63904      174 SPMIPARQVSVLVLEYYLLSGCvgn----evDLEASLKREVDSAAVAWRKRIFVEgg----llKAAEVDARGLILFIAIF 245  soybean
XP_025879883  188 --------ACELLLLSYVRAGCplrpg--qeagDDHLRAEAREAALSWRSRLVRSkgr---vaAAAANDARGLLLLMAAF 254  Japanese rice
XP_004986116  235 --------ACMLLLELYVRAGCprpp-gqghGEAAELRQEAREAALTWRSRLLRVsgr---vgDAGARGARGLAFFMAAF 302  foxtail millet
XP_002961449  311 GIASEYDDEELCRLVTTVA---RRRQSPALCRALGLAPKIPDVVDKLAKEGKQVEALAFAHAFEIMDRVEPVP-LLKAYL 386  Selaginella m...
O04650        958 GLVHATSQDNTLRFASYVA---HFKQAPKLFESLGLSYAMPNLVKKLLDERHYFMAIRFIFYFKLKFNFSPLE-LLKDEI 1033 thale cress
XP_015629797  596 AIAGNLEVKEMM-VFKTVG---DRDGGAELIKSLGLPDRATESINRLMKRREHIDAVKVARAFNLIDKFPPVS-VIKAYV 670  Japanese rice
Q10HH4        424 NIVSEFSVDEIFCIFGTLSrkqQKKNCIELCKGLGLVNRITDLIDYLIGNGQQLEALLLTQAFNLIDKYTPLS-LLKGYV 502  Japanese rice
XP_004252292  184 GIPQIFYNEDIRDLIRVSN---IREISTALRRSNVLMEKIPDIIAGMVKNKMEVDAVDVAYTFGVEEKCSPCE-ILSSFL 259  tomato
XP_015169712  348 GIPQAFRNEDIKDLLHQSY---IKMISSSVRRSSVLMAKIPEIIEGMLNQNMVVDAVYFTFCFGLEDRFNPQR-LLTSFL 423  potato
XP_002511054  271 GIPKVFTSGDIWDLIRSSN---LQQISDALKRSHVLVTKVSDILERMMNNGMKIEAIDVAYTFGIEDKFPPQK-LLTSFL 346  castor bean
KRH63904      246 GIPTVFKDEDIYSLVSASN---GREFSDALLKSQPLLKRVSDVADGMIKKGMAVKAVDLAYTFGFEEKYSPRT-ALTSFL 321  soybean
XP_025879883  255 GVPVEFPSQEIFELLHAAG---GLACAEVLKCSKHFLDKLRDVVAHMLNRGIYHQTVATIIAFELQDAF-PLSaIATCVI 330  Japanese rice
XP_004986116  303 GVPVEFPAQELYELLVAAD---ISACTKVLKFSKHFVKKMRDVVVEMINKDMHLQAIRIILAFELQNAF-PVEsTLTHIM 378  foxtail millet
XP_002961449  387 KDAR-------KSAQVILKNGNNSaAAQNDSSMKELSALKSVIKCIEEYKLDAQ--FPPQSLQKRIDVLERAKADRKRA 456  Selaginella mo...
O04650       1034 ITLR-------VSTKEKR-------RLDSQAEDRDAAKLKDIIELIEDFKLDID--LPVELIVKFMVPRENQNENQYVV 1096 thale cress
XP_015629797  671 EKVK-------EAAQDMVSKDAVSlQALDRAMQEDVAALRSAKEAIEAHDSGSD---YRYTIMQEVHKLMRSYEKKKRS 739  Japanese rice
Q10HH4        503 ERAK-------QNALDIINMNSPR-KSLSPLITKEVDSLMVAQNIVQQQITDFN---VRSGMLAEMKKLLDQYATKRSS 570  Japanese rice
XP_004252292  260 EELR-------ESLKKKKCQSHGShaVVNEANKRELSTMKSVIECLEAHNIDPSklIPRFRISDRIMSLEEKIARNDQr 331  tomato
XP_015169712  424 HESEvslcnkiQTFEQNKGSKDSAlQEIIGAKRRYLGTLKSVIQCLGRNNIDHSkfLSEWQIGEKVIGLEKEITQFRKN 502  potato
XP_002511054  347 RDSK-------EALKRRRREANNSpVLLKEASQKHLSTLKSAMKFLEGRKLDPKklLPGWQVTEKIDKLEKEIADLNRK 418  castor bean
KRH63904      322 QKSE-------ETWKKAKQDARDFpSALKVAHEKYLAALKSVVNCLEGHKIDFVklLPGWQLKNKITNLEKDIGDANKK 393  soybean
XP_025879883  331 ERVG-------RTKDQDSQEQHHL-PGSKENDEEKLALLRLLSKYVEDPKQCST---ENFSIADRIAMLEQSLAKPHQA 398  Japanese rice
XP_004986116  379 EKLD-------HDRKDESEGQA------LARDEEELTLLRSISKCMENHKLCPS---EFPNFAERIALLEERVGKPKQA 441  foxtail millet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap