Conserved Protein Domain Family
Calmodulin_bind

?
pfam07887: Calmodulin_bind 
Calmodulin binding protein-like
The members of this family are putative or actual calmodulin binding proteins expressed by various plant species. Some members are known to be involved in the induction of plant defense responses. However, their precise function in this regards is as yet unknown.
Statistics
?
PSSM-Id: 400303
View PSSM: pfam07887
Aligned: 63 rows
Threshold Bit Score: 332.569
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006659322 104 LKLVFAK-QLK-LPIFTSNRLVDIDNNPMQIHLVDARTNhmvmpASTHPASSSTKLELLVLDGDFRC-EDRPGWTGDQLS 180 malo sina
XP_015690753 114 VQLRFVN-NNPkITQYTDSAVEWKNGKDVKVAVFENDNQ------IKQGDLSKVEVDIVSVHSDLFTkRRQENFTKEEFD 186 malo sina
XP_015632507  35 VKLFFVDvERPeDPLFTGSPVQWQNGANAKVAIFENGSQ------ITQGGLSKLQIEILPVHDDFFTeRGPANFTKEEFN 108 Japanese rice
KQK12923     150 IKLRFLNvERPnDPLYTGCPVQWKHGKNAKVAIFENERQ------ITQGDLSKLQIEILSVHADFFTeRGQVDFTKEEFD 223 stiff brome
EEE53408      82 VQLRFLD-NLK-TPVYTEKNITAESNEAIRIGIFEGDNM------ITDGPLSKVKVEIVVLRGDFSN-DGRVSWTEEQFN 152 Japanese rice
XP_006663653 152 FELRFLN-KLN-PLVYTKDKITAEDGAAIKIAIFQNNQI------VKSGPLSSARIEILALEGDFID-VVPDNWTESQFA 222 malo sina
Q2QZV8       176 VELRFLN-KLN-PLVFTKEKITAEDGTAIKIAIVRDNQI------ITSGPLSSARIEILALHGNFYD-VVPDNWTESEFD 246 Japanese rice
7_pfamImport   1 VELRFLN-KLN-HLVYTKEKISAEDGKAIKIAIFQDNHI------VKYGPLSSARIQILALHGNFNN-GVPENWTERQFD 71 
KAE8815866    98 YKLRFLN-GLS-NEVFTKKEIRCANGDPLKICLEDNNQQ-----ENNSRRLLSAKIKIVVLDGDFNI-DNEDCWTLENFS 169 Hordeum vulgare
VAI37382     140 VKLRFVDvDRPeDPIYTGYPVQWLNKKDARVAVFENDRQ------ITQGDLSKLQIEILAVHAEFFTeRGQADFTKEEFN 213 durum wheat
XP_006659322 181 AAIVRAREGRRPLLVGAgLSRTMDrHGVAVIDEVSFTDNSSWIRSRKFRIGVRVVPaaNNQaAVRIQEAV-SESFTVKDH 259 malo sina
XP_015690753 187 KQI-CRSGHKELVLA----AFNLN-NGEGSLDSICFTESS---HGKEWRLAARVKT---QVpRVRFEEAV-TDPFVVKVD 253 malo sina
XP_015632507 109 KQI-YMCKGKESVLK----TVNLT-NGEANLGSFFFTESS---HGKRLRLAARVKY---QDlAVRVQEAT-SYSFVVKDR 175 Japanese rice
KQK12923     224 KQI-YIYKGKDSVLT----SVNLK-NGEADLGPVFFPESS---YRKRLRLTARVKR---KDlAVRIQEAI-TDPFVVKDR 290 stiff brome
EEE53408     153 NHIVQGRNGQGFVLGGD-CGVWLK-KGENRLGKIRFKEGSSRTRSRMFILGARVCK--SENtGVRVQEAV-MKPVTVLDR 227 Japanese rice
XP_006663653 223 SHI--PNFPQGPVLGGV-CQIKLK-NGEASSSDVSFNMPSSKTPSGKFILAARVHS--SDQpGFRIMEAL-MNPAVVQVH 295 malo sina
Q2QZV8       247 HRI--VSSSQGPALGGV-CQVKLK-NGEASPSDVFFNIPSSKTESGRLILAAKVHT--SDIgGLRIKEAVmMNPVVVQVY 320 Japanese rice
7_pfamImport  72 ERI--VKSQKGNVLEGD-CQVKLK-NGEASLSDISFNIPSGKTETGKLILAARVVS--SDRtGLRIMEAV-MDPVKVQVY 144
KAE8815866   170 RHIVRPRDKIGAVLTGE-LEVSLK-NGKADLRDATFIDNSKFTRSGKFRLGVMVVD----GlGERILEGI-TEPFTVKDR 242 Hordeum vulgare
VAI37382     214 KQI-CIHKGNESVLT----TVNLA-NGAAYIGSVIFTESS---QRKRLRLTARVKG---QDlDVRVQEAI-TDPFVVKVG 280 durum wheat
XP_006659322 260 RGELYKKHYPPVLTDNVWRLKNIGKDGPIDKRLEAEGVKNVQDFLKLNTIDPNKL-KSLVG--MSDRQWSATLNHAKTCD 336 malo sina
XP_015690753 254 RSKTYAKSYPPLKEDDVHRLVGISPKGKFRDNLVGKGIANVKQLLRHYYIDGSAL-QELIG--MKNRAWKDMIDHAKTCH 330 malo sina
XP_015632507 176 RSKLNKKSNSPSKEEGIHCLKKISLKGKRCNDLAGKYITKVKHLMRCYHRDPAGL-QKLTG--MKNEDWNTMISHATTSD 252 Japanese rice
KQK12923     291 RSEFNEKIYPPPKDEAIHRLEKISLNGKCWGDLVDKKITMVKHLLRHYYRDSSGL-QKLTG--MKKGSWSTMIKHATTSD 367 stiff brome
EEE53408     228 RNEANEKRHPPMLDDEVFRLEEICKDGTYHKRLQKAKIFTVHDFLKALNTNAKKLrEEVLQmkKKTNSWDKMVGHARECC 307 Japanese rice
XP_006663653 296 RNKLNRSSDRPKLKDEVHRLKGISRTGCRAKWLKDNQINTVEEFIKALNKDEEKIrNECFKlkKDNKDWKDTVTHARECD 375 malo sina
Q2QZV8       321 RNKLNRSSDRPKLKDEVHRLKGISGKGCRTKWLKDNQINTVEEFVKALNKDEEKIrNECFKlkKDNKLWKDTIKHAKECD 400 Japanese rice
7_pfamImport 145 RNKQNRISDRPKLKEKVHRLKGIARNGGRDRRLKNNQIYTVEDF-KALNKNEEKIrAECFNvnPDDKQWKATVEHARECD 223
KAE8815866   243 RGEGYQKHAIPSLDDDVWRLQKISKDGVFHGALKRSGIFSVKDFLTSYYKDEHTL-RKVLNk-ASKLVWTTIIDHAKRCD 320 Hordeum vulgare
VAI37382     281 RSKQNRKSYPPSKEEAVYRLEKISLKGKHCTLLSEKNITTVKQFLRHYYRDESGL-QKLLD--MKE-DWSTLIKHATTSD 356 durum wheat
XP_006659322 337 M-Gg-KCYIF--KSEGCDLTFNPVGEILAVRIGDQVSSLH--DLIPLQMVQIRQLANQAYKQWDQLEEV 399 malo sina
XP_015690753 331 P-Gn-ELYYYtaMEKNYELCFNDFYELVGVKRDGKYTAYC--NLDHSQQRKVNNWKKSAYKKFEDLEKN 395 malo sina
XP_015632507 253 P-Gd-EIHSYr-vEKNTIIFFNDFFALVGMSVDGSYAPYHanNLNQLQQRKMNKWKESAYQKFEELEKL 318 Japanese rice
KQK12923     368 P-Ga-EIYSHrvEEENYELLFNDFYDLVGIMINEAYVPYS--GLDQLLQVKVNNWKMSAHKKFEDLENS 432 stiff brome
EEE53408     308 LrDqhELKAYqsEEENATLFFNGVHQIVGAKFGGDYVIYE--NFDPAQKTKVNKLKDRAHAKLDDIPSd 374 Japanese rice
XP_006663653 376 LeGnrKLKSYrvEEQNVVLFFNCVHDLVGAAFRGCYASKN--TFSSDQQETVNFLKKQAYDVLDDIAFD 442 malo sina
Q2QZV8       401 LeGncKLKLYraEEQHVVLFFNCVHDLVGAKFRDHYVAKD--NFSSDQQDAVNRLKKQAYDELDSIGFD 467 Japanese rice
7_pfamImport 224 LeGdcNLKSYr--vQNVVLFFNCVHDLVGAEFHGFYASKD--SFSSDQKDAVNSLIKQAYDVLDDIAFN 288
KAE8815866   321 P-Gk-ELYSFivEGHNVVLFFNCFYRVVGVTSSDQYIPFK--DLDKPMQGRVKQWSKVAYETLTNLQPD 385 Hordeum vulgare
VAI37382     357 P-Gl-EIYSFi-vEENTELLFNDFYNLVGMMIGGLYFPVN--GLNQFQQIIVNKWKMSAYEKFDERENS 420 durum wheat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap