1FUI


Conserved Protein Domain Family
Fucose_iso_N2

?
pfam07882: Fucose_iso_N2 
Click on image for an interactive view with Cn3D
L-fucose isomerase, second N-terminal domain
The members of this family are similar to L-fucose isomerase expressed by E. coli (EC:5.3.1.3). This enzyme corresponds to glucose-6-phosphate isomerase in glycolysis, and converts an aldo-hexose to a ketose to prepare it for aldol cleavage. The enzyme is a hexamer, with each subunit being wedge-shaped and composed of three domains. Both domains 1 and 2 contain central parallel beta- sheets with surrounding alpha helices. The active centre is shared between pairs of subunits related along the molecular three-fold axis, with domains 2 and 3 from one subunit providing most of the substrate-contacting residues.
Statistics
?
PSSM-Id: 400298
View PSSM: pfam07882
Aligned: 48 rows
Threshold Bit Score: 314.517
Threshold Setting Gi: 123725458
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FUI_E               175 KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED-EN-----NKQ 248 Escheri...
Q8XNL5               173 KSYVNIGASSMGIAGSQVDISFFEDYLGMLVEFVDMTEILRRIHLEIFDPIEYDKALNWIKENCREGID-INegkdlPDI 251 Clostri...
microsynth:EHR_02425 172 KSYVNIGASSMGIAGSQINQTFFEKYLGMQVEYVDMTEVLRRIELNIFDPKEYDTIRTWIKQYCQEGID-INagksfPEV 250 Enteroc...
WP_014223768         179 KSYLSIGAVCMGIAGSIVDSNFFENYLGMRCEGVDEVEIIRRMENDIYDKEEYKKALAWAKKNCKQGEDiIN-----RKD 253 Tannere...
WP_038554399         178 KSYLSIGYSSMGIAGSMVDSGFFQKYLGIRTVFVESVEILRRIEEGIYDEEEFQKALAWTKANCKEGKD-IN-----KPQ 251 Draconi...
CDF80771             177 KSYLSIGYSSMGIAGSMVDVNFLQDYLGVRAEFVESVELLRRIEHNIFDQDEYKKALAWTKENCKEGPD-RN-----SPE 250 Formosa...
jgi:SpiGrapes_2577   189 KSYLSIGGCAMGIAGSIVDQDLLQSYLGMRTEAIDMCEIERRIVEEIYDHEEFKKAIKWVKENCIQPKDtVN-----EEK 263 Sphaero...
WP_012420864         174 KGYLSIGGCSMGIAGSIVDQSFWENYLGIRVQAVDMTEVRRRMDQKIYDEAEFDLAMQWADSVFKFAED-KN-----RPD 247 Akkerma...
Q2NWL9               176 RSYLSLGGVSMGIAGSIVDHHFFEAWLGMKVQTVDMTELRRRIENEIYDRDELALALAWAEANFRFGQD-TN-----AAE 249 Sodalis...
CAP56600             174 rTYLSIGGVSMGIAGSIVDHAFFRSWLDMRVQAVDMTELRRRLDRKIYDTAELETAQAWADARFRFGIE-RN-------A 245 Glucona...
1FUI_E               249 YQRNAE-QSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNG 327 Escheri...
Q8XNL5               252 VKKSKViPADKDWEFIAKQAIIIRDILYRNEKLGDLGWEEEARGRNAIAGGFQGQRQWTDWLPNGDFTEAIMASTFDWNG 331 Clostri...
microsynth:EHR_02425 251 ITKSRYiAEEDQWDFIAKQTLIVRDLLFGNPELAKLGWLEEAKGRNAIAGGFQGQRQWTDWLPNGDFMESILTSTFDWNG 330 Enteroc...
WP_014223768         254 LAKTKA-EHEKDWEFTVKMTLIVRDLMVGNPKLKSLGFGEEALGHHAIVAGFQGQRQWTDFYPNGDFTEAILNSSYDWSG 332 Tannere...
WP_038554399         252 NQADAA-RKEYEWEMVVKMTLICRDMMIGNKKVIEKGFHEEGVGRNAILGGFQGQRQWTDYQPNGDFTEAILNSSFDWNG 330 Draconi...
CDF80771             251 SQKSAE-VKEKEWEKVVKMTLICKDLMNGNPKLKAMGFGEESKGRNAIMGGFQGQRQWTDYQPNADFTESILNSSFDWNG 329 Formosa...
jgi:SpiGrapes_2577   264 YRRSEE-QLEKDWEYCTKMTMIGRDLMIGNKELKKIGFGEESLGHNALFAGFQGQRQWTDHWPNGDFMETMLCTSFDWNG 342 Sphaero...
WP_012420864         248 LKLDEA-GRRKTFRESVLMAMIFRDMMQGNPKLKKIDREEESLGYQAIAGGFQGQRHWTDFYPNGDIAETLLNSTFDWNG 326 Akkerma...
Q2NWL9               250 HRRSPE-GYRGVLRESLQMTLCIRDMMQGNPRLISLGFTEEAQGYDAIAAGFQGQRHWTDQYANGDIAEALLNSAFDWRG 328 Sodalis...
CAP56600             246 RPRDAA-GKREILSESLAMTLCIRDMMHGNARLAAMGWAEEALGYDAIAAGFQGQRHWTDQYPNADVAEALLNSSFDWSG 324 Glucona...
1FUI_E               328 VREPFVVATENDSLNGVAMLMGHQLTG 354 Escherichia coli K-12
Q8XNL5               332 PRQVTAFATENDTLNGVSMLLGTLLTN 358 Clostridium perfringens str. 13
microsynth:EHR_02425 331 PKQPVSFATENDTCNAAAMLFGSLLTN 357 Enterococcus hirae ATCC 9790
WP_014223768         333 IRAPFILATENDSLNGAAMLFGHLLTN 359 Tannerella forsythia
WP_038554399         331 IRQAFVLATENDSLNGVSMLFGHLLSN 357 Draconibacterium orientale
CDF80771             330 IRQAYTFATENDCLNAISMLFGHLLTN 356 Formosa agariphila KMM 3901
jgi:SpiGrapes_2577   343 IREPFVMATENDFLNGIGMLFGKLLTN 369 Sphaerochaeta pleomorpha str. Grapes
WP_012420864         327 PRAPLPFATENDSLNGACLLFGYLLTG 353 Akkermansia muciniphila
Q2NWL9               329 VRQPLIVATENDSLNAVAMLFGHLLTG 355 Sodalis glossinidius str. 'morsitans'
CAP56600             325 ARAPSILATENDCLNGATMLFGLLMSG 351 Gluconacetobacter diazotrophicus PA1 5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap