Conserved Protein Domain Family
PHB_acc_N

?
pfam07879: PHB_acc_N 
PHB/PHA accumulation regulator DNA-binding domain
This domain is found at the N-terminus of the Polyhydroxyalkanoate (PHA) synthesis regulators. These regulators have been shown to directly bind DNA and PHA. The invariant nature of this domain compared to the C-terminal pfam05233 domain(s) suggests that it contains the DNA-binding function.
Statistics
?
PSSM-Id: 400295
View PSSM: pfam07879
Aligned: 66 rows
Threshold Bit Score: 88.7244
Threshold Setting Gi: 81589547
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Turpa_0284    3 IIKRYANRRLYDPETSRTITLDEVAQYVRDGVDIKVIDNTNGEDITRKVLGQTFLKLN 60  Turneriella parva DSM 21527
Q2RZ51            4 RIKRYDNRKLYDTETSEYVSLSDIAALVRQGNTVEVVDKATGEDITAQTLTQIILEEG 61  Salinibacter ruber DSM 13855
WP_011956889      3 TIKKYANRKLYHIDRKQYITLEGIAALVQAGEQVRVVDNETGEDITAQILAQVALQTR 60  Roseiflexus sp. RS-1
jgi:Caur_3285    25 LIKKYANRKLYHTNQKRYITLDGIARLVQEGETVQVLDNETGDDITANILAQVVLHAR 82  Chloroflexus aurantiacus J-10-fl
BAL98839          3 VIKRYPNRKLYDTEAKRYVTLDQIAEMIQARKDVLVIDHETGEDLTNLTLSQIIFEQE 60  Caldilinea aerophila DSM 14535 = N...
OUHSC:BDW_00790  22 IIKRYQNRKLYDTQQSCYVTLDDIAKMIRANEEVMVIDNKSKNDITAATLTQIIFEAE 79  Bdellovibrio bacteriovorus W
CBW27768          6 IIKRYQNRKLYDTHQSCYVTLEEIAQIIREGHEIQVIDNKTKNDITYMTQIQLLFDQE 63  Halobacteriovorax marinus SJ
WP_014399112     18 IIKRYTNRKLYDTVESRYVTLDEIAAMIKEGTEVRIVDNRTKEDLTSVTLAQIIFEEE 75  Corallococcus coralloides
jgi:Hoch_1898     6 IIKRYANRKLYDTQHSRYVTLEQISEMIRHGDDVKIIDNKTKDDLTTVTLAQIIFEEE 63  Haliangium ochraceum DSM 14365
CAN97734         17 VIKRYSNRKLYDTKDSRYVTLQQIGEMVRAGEEVQIIDNATKEDKTEVTLALIISEDL 74  Sorangium cellulosum So ce56
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap