4C89,4KRY,3GA7,3AIM,1JJI


Conserved Protein Domain Family
Abhydrolase_3

?
pfam07859: Abhydrolase_3 
Click on image for an interactive view with Cn3D
alpha/beta hydrolase fold
This catalytic domain is found in a very wide range of enzymes.
Statistics
?
PSSM-Id: 400284
View PSSM: pfam07859
Aligned: 93 rows
Threshold Bit Score: 151.595
Threshold Setting Gi: 81841635
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4C89_B       118 LVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRD----AETXITVAGDSAG 193 Lactobacillus p...
Q8Y297        78 VFYLHGGGYFFCSPRTHRSITIGLAVHARARVFALDYRLAPEHPFPAAVLDALAGYRGLLAQr---vAPSRIVVAGDSAG 154 Ralstonia solan...
Q9I217        76 VLYLHGGAYLIGSPATHRAITTHLARRCAAEVCAVDYRRAPEHPFPAARDDALAVYLALLEAGh---SPRRLLLAGDSAG 152 Pseudomonas aer...
Q9X8J4        27 LLYLHGGGYLAGSPDTHAGLAGELARRAGLRAVSVDYRLAPEHPFPAAVDDGLAAYRELLSTGt---DPQDLVLAGDSAG 103 Streptomyces co...
O83905        73 VLYAHGGFFISGSPMASRALCASLADEVGAKFYIPAYQLAPEHPFPAALENMYDAYVALIDQkk--fRPEDIIFSGDGAG 150 Treponema pallidum
Q8EJ56        78 LFYIRGGGFCFKTPNAHARLIADISARCQLDTFIPDYRLAPEHPFPAPCDDVLEAYLHLIELk----GDDNLILMGDSAG 153 Shewanella onei...
Q89KB8       133 VMFLHGGGFINEIVPAHWRLIGQMTREARVVCVVPIYPLAPRVTAKDVVPATAELLRMLLEDa----GPAKVTVVGNSAG 208 Bradyrhizobium ...
Q5HLP4        78 ILYLHGGYNTLQPSPFHWRLLDKLTLNTLHEVVLPIYPKSPDYHYLETFKAIRDVYNQLVEEv----GANNIVMMGDGSG 153 Staphylococcus ...
WP_010907666  94 VLYLHGGAFLGCGANSHRRLVETLSKLADSPILVVNYRLLPKHSIGMALDDCHDGYQWLRRLg---yDPEQIVLAGDSAG 170 Mycobacterium l...
KQH80609      91 LLYIHGGAYSMCSPETHRGLLGELASASGRPIFAVKYRLAPRYPYPAAADDALNAYRWLTSGGspgsCQRTVAVAGDSAG 170 Mycobacterium g...
4C89_B       194 ANVIXAATNLNQQLgsnrINQQLLLYPVTapnaDHAGPLWdlaAFPiidSQRAILtnyhdlfrqldsIXTDY---YVPe- 269 Lactobacillus p...
Q8Y297       155 GGLSLALLVALRDAgdplPAGAILYSPWTd--lAATGASLv-eNDA---SD-VMFrga------wmaRGATL---YLGd- 217 Ralstonia solan...
Q9I217       153 GHLALSLALELKARglplPAGLLLFSPWTd------lGCQrlhTPAa--GD-PLLsra------wleSAVRL---LL--- 211 Pseudomonas aer...
Q9X8J4       104 GGLGIATLLAAREAglpqPAAVALFSPWVd--lTLTGGSIr--SKEg--AD-PIFtea------dvrAYADL---YVG-- 165 Streptomyces co...
O83905       151 AGLMLALTHYLKQKglvcPRALALISPWVd--lTEDRFAGe-gVKK---KE-LLLtrd------mfrYCALQ---YTY-- 212 Treponema pallidum
Q8EJ56       154 GNLALSLLLELKRLnlspPKACVLLSPALd--lAITGDTEl-iLAA---DD-PFFtl---------eSLLRLrgaYLA-- 215 Shewanella onei...
Q89KB8       209 AGLALAACQWLRDRghrqPNLMVLISPAAd--aSVSRPEQv-eIAA---RD-PMQdip------gilEAGRL---YAG-- 270 Bradyrhizobium ...
Q5HLP4       154 GGLALSFVQSLINDnqevPRKLFLLSPLLd--aTLTNPNItktLE----ENDILVsrf------gvhQLMKS---WTN-- 216 Staphylococcus ...
WP_010907666 171 GYLALALAQRLQDVge-ePAALVAISPLLq--lAKKGKQAh-pNAK---TD-AMFppk------afdALGRL---VASsa 233 Mycobacterium l...
KQH80609     171 GQLTMATALGARAVglplPDAMLLMSPVLd--lRCELARA---REIr--RRDPFAsaq------saaRALDL---YVG-- 232 Mycobacterium g...
4C89_B       270 -NFDSHSP---LISPLhqeNFTXTPPTTIXVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFA 333 Lactobacillus plantarum WCFS1
Q8Y297       218 sGVPADHP---LASPLy-aDFTGLPPLHCYVSTSEVLRDDTLRMAERARAAGVSVSVELGRRLPHVWP 281 Ralstonia solanacearum
Q9I217       212 -PADAE-PgsaALSPLh-aDLAGLPPLLVQVGEDELLRDDSLRLAQRAGEQGVAVRLQRYAGCWHVFQ 276 Pseudomonas aeruginosa
Q9X8J4       166 -AGDRAAP---LASPVf-aDLAGLPPLLVQAGANEVLLDDAVRLAGRAGADDVEVTLEVGPGLPHVYQ 228 Streptomyces coelicolor
O83905       213 -ADNFRNS---LVSPLf-gNFGDFPPVFVQCGEQELFHTDACALAQILEGAGVQVTLDVWPGMWHLFQ 275 Treponema pallidum
Q8EJ56       216 -GANPMSE---RVSPLq-gNLAGLPPLLVIAGTRELLLQDSERLVMQVNACGGEVESRFYRNMPHVFP 278 Shewanella oneidensis
Q89KB8       271 -ELDVGHP---FVSPLn-gAFRSLPPMTIFAGTRDLLYPDSVDLAERARAVGVPVELHLLRNQPHNYA 333 Bradyrhizobium japonicum
Q5HLP4       217 -DLPLSDA---RISPLy-gTLKGLPPIYMYGGGREILSPDMHAFTHALEECGNDVEFKEYPKMVHDFP 279 Staphylococcus epidermidis ...
WP_010907666 234 aKNKVDDKpeeLYEPLd-hIAPGLPRTLIHVSGSEVLLHDAQLAATKLAAVGVPAEIRVWPGQVHVFQ 300 Mycobacterium leprae
KQH80609     233 -GADRGDP---RLSVLd-aDLTSMPPILIQVGGREMLIDDSRRLAERLQSAGSHVEIQVYRGQIHVFQ 295 Mycobacterium gordonae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap