2BNG


Conserved Protein Domain Family
LEH

?
pfam07858: LEH 
Click on image for an interactive view with Cn3D
Limonene-1,2-epoxide hydrolase catalytic domain
Epoxide hydrolases catalyze the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism. Limonene-1,2- epoxide hydrolase (LEH) differs from many other epoxide hydrolases in its structure and its novel one-step catalytic mechanism. Its main fold consists of a six-stranded mixed beta-sheet, with three N-terminal alpha helices packed to one side to create a pocket that extends into the protein core. A fourth helix lies in such a way that it acts as a rim to this pocket. Although mainly lined by hydrophobic residues, this pocket features a cluster of polar groups that lie at its deepest point and constitute the enzyme's active site.
Statistics
?
PSSM-Id: 400283
View PSSM: pfam07858
Aligned: 6 rows
Threshold Bit Score: 163.422
Threshold Setting Gi: 81413555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BNG_C  15 TEAIRAVEAFLNALQNEDFDTVDAALGDDL-VYENVGFSRIRGGRRTATLLRRX---QGRVGFEVKIHRIGADGAAVLTE 90  Mycobacterium tubercu...
Q8XW85   2 PTPLETVSHFCAAFVEDGGRPAVRRWFTPDtRWVNEGVSATTGVDEAIAMIDGLetsMGISTVHFDVIAIAADGSRVLTE 81  Ralstonia solanacearum
Q73W09   9 VANTRTVEGFLNALQDADYDAAEAALADDL-VYENVGLPTIHGRARAMKLFRRM---EDRAAFEVKIHRIAADGGAVLTE 84  Mycobacterium avium s...
Q9CCC2  29 vENIRTVEVFLAALQDAGLRNRIRDVGRQPrVYQNVGLPTIHGRSKTITLWRKM---ADCIGFEIKIHRIAAVAIAVLCE 105 Mycobacterium leprae
Q9A482   6 PSPAQVVRAFMKAMERLDYDAAVQHLAPACeYTNPPPIGTVHGPAGVRAVLEPFf--APTLENEFRILREATDGGLVFHE 83  Caulobacter vibrioides
Q8XW86   2 STPIEIVTAFCATFPEDDGKAAIRRYFTPDtVWINEGISKTTGIEEAIAFLGRPnrsPSIAAVHFDILAIAADGNRVLTE 81  Ralstonia solanacearum
2BNG_C  91 RTDALII--GPLRVQFWVCGVFEVDDGRITLWRDYFDVYDXFKGLLR 135 Mycobacterium tuberculosis
Q8XW85  82 RVDRFERadGAEIGRVTLMGIFKVEGEKIVEWRDYFDVNALQAFNAG 128 Ralstonia solanacearum
Q73W09  85 RTDALIF--GPLRLQFWVCGVFEVQNGRITLWRDYFDFFDMLKATAR 129 Mycobacterium avium subsp. paratuberculosis
Q9CCC2 106 RADAVIV--GPLWMQFWVCGTFEVQNKRIMLWRNYFDLFDLFKATMR 150 Mycobacterium leprae
Q9A482  84 RLDRHRLkdG--WVELPVTGVYEVVDGKIAYWRDYFDAQTILSQWPR 128 Caulobacter vibrioides
Q8XW86  82 RLDRFVRadGSEIAAIRVMGIFEVEGDRIVAWRDYADVNAGRKITPD 128 Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap