Conserved Protein Domain Family
RanGAP1_C

?
pfam07834: RanGAP1_C 
RanGAP1 C-terminal domain
Ran-GTPase activating protein 1 (RanGAP1) is a GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state. Its C-terminal domain is required for RanGAP1 localization at the vertebrate nuclear pore complex, and is sumoylated by the small ubiquitin-related modifier protein (SUMO-1). This domain is composed almost entirely of helical substructures that are organized into an alpha-alpha superhelix fold, with the exception of the peptide containing the lysine residue required for SUMO-1 conjugation.
Statistics
?
PSSM-Id: 400266
View PSSM: pfam07834
Aligned: 14 rows
Threshold Bit Score: 254.6
Threshold Setting Gi: 1249043271
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_796931    388 QESKDPHLQVKGTAISPRREe--tKYMiPVTAADFLAFPTANKLQALGNQRAEKILQELgdEVYEESAGIKAFVKISSVM 465 purple sea urchin
XP_007259137 389 EHNCVNGTKENGKDKGSPAK----TNLcSPDLISFFHSPTSEKLFNLGAKRTQLIEQQL--DFSDAAKIADFFLQICSVY 462 Mexican tetra
NP_998154    395 EENGLNGTKDVIEEKEEPPH--------SSELMSFLVSPSAEKLISLGAKRVQLIEQQV--DVTDANKVSEVFLKISSVY 464 zebrafish
XP_014347472 403 QESPADQQIISSTGGHTPVSs---PP--LVDAATFLAFPSPDKLLKLGPKRSFLIAQQT--DVSDVEKVVQSFLKITSVY 475 coelacanth
AAI61050     403 NENRTKPNKI-SSHVSTPAA----PPKlPVDASTFLSFPSPEKLVRMGPKRSTMIMQQI--DVADTEKVVQTFIQVSSVY 475 tropical clawed...
XP_005039751 393 EQESLTPKKIIDSQASTPVP----SP--PVDVATFLAFPSPEKLLRLGPKCSVLIAQQT--DTSDVEKVVATLLRISSVF 464 Collared flycat...
XP_007502637 392 EEVTTPSKKILDTHVGEPPSvl----csPSDVSTFLAFPSPEKLLRLGPKSSLLIAQQT--DTSDPEKVVSAFLKVTSVF 465 gray short-tail...
XP_007661361 409 eDQKSTPKKIQGTQVGEPAPvicsPP--PVDVSTFLAFPSPEKLLRLGPKSPVLITQQT--DTSDPEKVVSTFLKVSSVL 484 platypus
XP_011476798 396 EEEEEEEEKSQVNKMSTPVS----APR-PPDVSSFLTFPSPDKLLKLGAKRALLVQQEV--DTTDGRKTAEAFLKIASVY 468 Japanese medaka
XP_023204726 396 EEQENISSSSNNNKPSTPMS----APR-PPDVSSFLSFPSPDKLLKLGTKRTLLVQQQV--DVTDARKTAEAFLKIASVY 468 southern platyfish
XP_796931    466 ESEnNDVKNAVYQCTDAILKKLFS-SEKCTPESVVNALLVHLGLIKGEDK-LRPVGDPSGMLLTLGHAVKQQYYPKSTAP 543 purple sea urchin
XP_007259137 463 EEE-VEVKQVVLETADTLLRKGFS-SPHFQTYLFISSLMVNMGLLKGEKK-TKKMGVLPGHLIVLNHCVGQDYFPVDQAD 539 Mexican tetra
NP_998154    465 KDE-PEVKQAVFETTDALLRKAFSnSPHSQSYSFISSLMVNLGLLKSEDKkVKKVSVLPGHLLTLEHAVSQEFFPADQAG 543 zebrafish
XP_014347472 476 KEE-TVVKSAVVETTDALLRKAFS-SPAFHSADFISSLLVHMGLLKSEEK-IKSVSSVYGPLVALNHVVQQDYFPRTLVP 552 coelacanth
AAI61050     476 RDD-SEVKAAVEETIDGLMKKAFE-SRGFQENLFITSLLVHMGLLKSEDK-IKTVQHLNGPLLTLNHMVQQNYFPKSLVP 552 tropical clawed...
XP_005039751 465 KDE-APVKTAVHETTDALMKKAFG-SATFNSDAFITNLLVHMGLLKSEEK-IKTVPSLYGILMTLNHMVQQDYFPKSLAP 541 Collared flycat...
XP_007502637 466 KDD-LAVKTAVQDAVDALMKKAFA-SATFNSNAFITRLLIHMGLLKSEDK-IKAVPNLYGPLMALNHMAQQEYFPKSLTP 542 gray short-tail...
XP_007661361 485 KDD-VSVKTAVQETIDALMKKAFS-TSTFNSDAFITSLLVHMGLLKSEDK-IKAIPNLTGPLMALNHAAQQDYFPKSLAP 561 platypus
XP_011476798 469 KEEnNDVKRAVLDTIDALLSKAFN-DTSFQGYNFVSALLVLLGLIKSEDK-VKPVLVVPGHLHAIEHAVRQDYFPKESVA 546 Japanese medaka
XP_023204726 469 KEEnNDVKNAVLDTIDALLSKAFS-TPSFQGYSFVSILLVLLGLIKSEDK-IKPVVVVPGHLHALEHVVRQDYFPKENVA 546 southern platyfish
XP_796931    544 IFMTFLSRPNSKIDDCVSAKHGLMQAIY 571 purple sea urchin
XP_007259137 540 VLLIFLSRNGKVLESCSKARDYLKTTLE 567 Mexican tetra
NP_998154    544 VLESFVSRNGAVLESCCSARDALKITLV 571 zebrafish
XP_014347472 553 ILTAFMSKSNRTLESCSFARHALLQTLH 580 coelacanth
AAI61050     553 ILLAFISKPNRVLENNASARHTLLHNLH 580 tropical clawed frog
XP_005039751 542 VLSAFVTKPNRALDSCSFARHMLLQTLH 569 Collared flycatcher
XP_007502637 543 VLLAFVTKPNRALEACSFARHNLLQTLH 570 gray short-tailed opossum
XP_007661361 562 VLVAFVTKPNHALDSCPLARHSLLQTLH 589 platypus
XP_011476798 547 VLKAFMSR-------------------- 554 Japanese medaka
XP_023204726 547 VLEAFMSRsnkslescgnarnglqstlq 574 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap