Conserved Protein Domain Family
DUF1644

?
pfam07800: DUF1644 
Protein of unknown function (DUF1644)
This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, and is probably a zinc-binding domain.
Statistics
?
PSSM-Id: 400243
View PSSM: pfam07800
Aligned: 59 rows
Threshold Bit Score: 214.354
Threshold Setting Gi: 1559637131
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN15889      32 DDASCPICIEHPHNAVLILCTSHEKGCRSYMCDTSYRHSNCLDRFKKLRPESRVSSHSYSDSSDSGRQPTHHPYESgyss 111 Amborella trich...
ERM97525      24 EEVTCPICLDFPHNGVLFQCSSYEKGCRPFVCDTNYTHSNCFNRFMNAYQVSSNPTQSENVSGTLNLIS----------- 92  Amborella trich...
XP_010648425  28 EDVTCPICLDFPHNGVLLQCSSYEKGCRPFVCDTDHLHSNCLERFKSAYGMSSELKSPSTSDADADAAAAASAENIqq-- 105 wine grape
XP_009127004  25 DDLVCPICLDSPHNGVLLQCSSYQNGCRAFVCNTDHLHSNCLHRFITACSTDSPPSTSPAAPEDNDETLSKV-------- 96  field mustard
XP_002527964  28 EEVVCPICLDFPHNSVLLQCSSYEKGCRPFVCDTDHLHSNCLDRFKSASGMSSPSTSDATTTANTQHSV----------- 96  castor bean
KRH16124      11 DDVACPICLDFPHNSVLLHCSSYDKGCRAFVCDTNQLHSNCLDRFKNSCGMPSSPVSNATSTETTENSDDHEV------- 83  soybean
KRH52575      11 EDVICPICLEVPHNSVLLQCSSYDKGCRSFVCDTSQLHSNCLDRFKSTHSMPSSSTYDSTSQMSDANSMANSESVV---- 86  soybean
XP_009409739  64 KDVTCSICLDFPHNGVLLLCSSYDKGCRPFICDTDQNHSNCLERFKSAHGVPAVAKDISASNGVSMVCIQDIS------- 136 wild Malaysian ...
ONM62927      30 EDVACPICLDSPHNAVLLRCASYEKGCRPFICDTDQTRSNCLERFRGAHGLPLPVPANARASSRTVAPLNSIHTITis-- 107 Zea mays
XP_015694378  29 EDVTCPICLDYPHNAVLLRCTSYEKGCRPFVCDTDQTRSNCLERFKGAYELP----ANMKVSTIAVAPLDSIHIVA---- 100 malo sina
ERN15889     112 prtrrrvpswvssssfgdfgmeetidgdssiaasenggptwgtdpyepggrgddsvigmslnqsgpiwangpstysgpsg 191 Amborella trich...
ERM97525         --------------------------------------------------------------------------------     Amborella trich...
XP_010648425     --------------------------------------------------------------------------------     wine grape
XP_009127004     --------------------------------------------------------------------------------     field mustard
XP_002527964     --------------------------------------------------------------------------------     castor bean
KRH16124         --------------------------------------------------------------------------------     soybean
KRH52575         --------------------------------------------------------------------------------     soybean
XP_009409739     --------------------------------------------------------------------------------     wild Malaysian ...
ONM62927         --------------------------------------------------------------------------------     Zea mays
XP_015694378     --------------------------------------------------------------------------------     malo sina
ERN15889     192 lgrpvGLGEsGLRCPLCRGLVLGWKIVKEARRYMDSKPRSCSRESCTFSGNYRELRRHARRDHPTIRPTEADPSRQRAWR 271 Amborella trich...
ERM97525      93 -----PGSEeHPVCPLCRGQVSGWVVIDSARTELNARKRRCEEEKCLFLGNYTELSEHMKLEHPHARPLEIDPARRLDWE 167 Amborella trich...
XP_010648425 106 ----lSEDScRPTCPLCRGEVTGWIVVDKAREQLDEKKRCCAEERCAFMGTYLELRNHAQLEHPHARPSKIDPARQLDWE 181 wine grape
XP_009127004  97 -----LEEScKPVCPLCRGEVTGWVVVEEARALLDEKHRSCEEERCRFIGTYTELRQHAKSEHPDSRPSKIDPARKLDWE 171 field mustard
XP_002527964  97 -----VDGNsRLACPLCRGEVSGWVAIEKARVHLDEKKRCCEEEQCTFTGTYLELCKHAQLEHPHARPSKIDPARQLDWE 171 castor bean
KRH16124      84 -----SNGQcNLTCPLCRGEVSGWVIVDKARIHLDEKKRCCDEVRCTFMGSYLELQEHAQLEHPHARPSKIDPARQLDWE 158 soybean
KRH52575      87 -----SDCQyKLSCPLCRGDVFGWIIVDKARVHLDEKKRCCEEEQCAFIGSYSELQKHAQLEHPHACPSKIDPVRQLDWK 161 soybean
XP_009409739 137 -----SSPSsQPTCPLCRGDVTGWLIIDEARVYLNTKKRCCEEKHCEYVGNFSELQKHAQLKHPHSRPSEIDPAQQLNWE 211 wild Malaysian ...
ONM62927     108 ---ssNANNnRPACPLCRGDVMGWFVIGEARSHLNQKRRCCEESRCSYVGSFHELQRHTQQKHPDSRPSAIDPARRADWE 184 Zea mays
XP_015694378 101 -----PNVNnRPSCPLCRGDVIGWIVINEARLHLNQKKRCCEEDCCSFVGNFNELQKHTQQKHPDSRPSEIDPARQVDWE 175 malo sina
ERN15889     272 RLEHQREYGDIVS 284 Amborella trichopoda
ERM97525     168 NLQQSSEIIDVLN 180 Amborella trichopoda
XP_010648425 182 NFQQSSEIIDVLS 194 wine grape
XP_009127004 172 NFQQSSEIIDVLS 184 field mustard
XP_002527964 172 NFQQSSEIIDVLS 184 castor bean
KRH16124     159 NFQQSSEIIDVLS 171 soybean
KRH52575     162 NFQQSSEIIDVLS 174 soybean
XP_009409739 212 NFQQSSEIIDVLS 224 wild Malaysian banana
ONM62927     185 NLQRSSDVVDVLS 197 Zea mays
XP_015694378 176 NFQQSSDIVDVLS 188 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap