Conserved Protein Domain Family
DUF1639

?
pfam07797: DUF1639 
Protein of unknown function (DUF1639)
This approximately 50 residue region is found in a number of sequences derived from hypothetical plant proteins. This region features a highly basic 5 amino-acid stretch towards its centre.
Statistics
?
PSSM-Id: 400240
View PSSM: pfam07797
Aligned: 50 rows
Threshold Bit Score: 53.6967
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9C745           125 LSRDEIEQDFSFVFGKKPPKRPKKRPRLVQKKLNTIFPGLWLneEEVTIDSY 176 thale cress
2_pfamImport       1 LSKEEIAEDFKAIRGTRPPRRPKKRPRTVQRQLDLLYPGFCL--ADVTPETY 50 
XP_018682863     195 LSREEIAEDFWKIKGMKPPRRPKKRPRNVQRQIEDIFPSSWM--LVVAPERY 244 wild Malaysian banana
AQK91837         151 LSNREKEEDFLVFRGSKLPQRPKKRAKVIQRTVNFVCPGTWL--CDLTLERY 200 Zea mays
JCVI:AT1G55340.2 120 LSNKEKEEDFLAMKGCKLPQRPKKRAKLVQKTLLLVSPGAWL--SDLCKERY 169 thale cress
ERN20394         224 LSSKEKEEDFMAMKGCKLPPRPKKRAKFIQKSLLLVSPGAWL--CELSQERY 273 Amborella trichopoda
XP_009130395     129 LSSKEKEEDFMAMKGCKPSHRPKKRAKLIQKSLLLVSPGTWL--ADMCPDRY 178 field mustard
EFJ29998          13 LSRKEKEDDFLAIKGSKLPQRPKRRTKHVEKTLHYCSPGMWL--CDLTRERY 62  Selaginella moellendorffii
XP_020177225     305 LSRKEKEDDFLVMKGTKLPQRPKKRAKNVDKSLQFVFPGMWL--SDLTKGRY 354 Aegilops tauschii subsp. tauschii
Q6L4G3           153 LTRQEIDADFFAITGRKAPRKPAKRPRSVQRQVDSICPGNSL--WEVSRDRY 202 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap