Conserved Protein Domain Family
DUF1633

?
pfam07794: DUF1633 
Protein of unknown function (DUF1633)
This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana. These sequences are highly similar and the region concerned is about 100 residues long.
Statistics
?
PSSM-Id: 116408
View PSSM: pfam07794
Aligned: 2 rows
Threshold Bit Score: 922.748
Threshold Setting Gi: 75100217
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZQ10   1 MTRLFSAPHLTAQIRRGEEISTISKIVVMMAsLNNFPHLHSISRQLTRLP------------------------------ 50  thale cress
O81434   6 MERLFSAPHLTVQIRRGEEISAISKIVVMMA-LNNFPPLHLTSRQLTQLSrsrknlvfifllspsflcysllldlpsllf 84  thale cress
Q9ZQ10  51 --------------SDLDDSQNKSNHSYGDDDSSSKMRSAassrqepRRVITLGGMGPIRRPSTRVDKPKKKKAPKQKGS 116 thale cress
O81434  85 sfnslvllcrkpkmSDFEDSQNKSNHSYGDNSSSSPPRVQ-------KRVITLGGMGPIRSPSTRADKPKKKKAAKQGGG 157 thale cress
Q9ZQ10 117 LPMTNNDLevldsgggdydtpkvaaVTQERAGGVGLCLRQFLREmwavlpdsgvhprdallPRLRLsSNVSkfrpprAG- 195 thale cress
O81434 158 TPMTNSDL-----------------VDLRRRCQVPVEVHMILSR-----------------PPLHL-ENVS------VGw 196 thale cress
Q9ZQ10 196 -VIYPGLRGEQRIRLPRPAAalsgqdqrqeRPRDVlhkcsswisdprwseGLSGYKLASQILLLQGghhsvgdfdparit 274 thale cress
O81434 197 cCAYANFFEKCGLFFPIPAS----------RTKEV---------------TLSQTELELLTLLRRG-------------- 237 thale cress
Q9ZQ10 275 rtcknqrnhffrdetlsvdpssklSNRLATFNRDRNVTALPIDPADPVIALPAAQPDPLEEVPQLYFRPSAYFQKkneVT 354 thale cress
O81434 238 ------------------------QTDWSTFSRDRIVAALAVAPAVPAIVPPTAQLDPIEEVPRIEPVPQADLPI---IP 290 thale cress
Q9ZQ10 355 KSSCSTSQ--------CGT----------SARAGDLSAVVAAARTSLAASHTQASTSHPSLPAANarpllrrrarllpvv 416 thale cress
O81434 291 PDSSSTSElplirrmrCPSlhvqranaeaHARADDLSAAVTAARNTLAVSNASASASHPSLPEVN--------------- 355 thale cress
Q9ZQ10 417 rltaelividqevapsreervkplAANPEAAVSVdrrssgrsqgrgrgsrgrgpnrsqevrqtsnlgggSAGNRpfhwsy 496 thale cress
O81434 356 ------------------------TGTSAAAVAI-----------------------------------AATNK------ 370 thale cress
Q9ZQ10 497 thdrdhpiiedkaglanLLRHIKGRNCQVPgdccykqvgcslraTSKQGSFGERARRREDPHLGVDSEREVRSGARgivp 576 thale cress
O81434 371 -----------------LVALYEQRLSQVP--------------SASELEEGKTLIRELTSSVKAGQDREVSFQAE---- 415 thale cress
Q9ZQ10 577 gMLRLKMELSTSKDLEKGYAEKIKIMEQEFRGLEADKQMARNQIHRLNEKKDELSKRVLDLTSIAQGVNKAVHDAKVELA 656 thale cress
O81434 416 -IERLKIELSTSKDLEKGYAEKIGFMEMEFGGLQADKQTARSQIHRLEQRREELSKKVMDLTSSAQGAKKAVHDAKVELA 494 thale cress
Q9ZQ10 657 ASYSKLLSGIKDKWVAKKEFTVLESQAAEVESNLALIDQIVKAAVDLTVEKPRFQAEIDDVEARCTLKEVSDFTLSKLDI 736 thale cress
O81434 495 AAYLKLLAGIKEKWVTKKEYTVLEGQAAEVESNLALIDQITKAAIDLTLEKPRLQAELDDLEARCKSKEVSDFTLSKLDL 574 thale cress
Q9ZQ10 737 PEVSEMLVVRPMNVDEQGTPIGLDEFGSNKDTFPRGLEEDPGTVFATPAGGSKE 790 thale cress
O81434 575 PHVSEISVVRPIDVDEQGTPIGLDEFGSNKDAFPGGLADGSGTVFAMPAGESRE 628 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap