Conserved Protein Domain Family
DUF1629

?
pfam07791: DUF1629 
Protein of unknown function (DUF1629)
This family consists of sequences from hypothetical proteins thought to be expressed by two members of the Xanthomonas genus. The region in question is 125 amino acid residues long.
Statistics
?
PSSM-Id: 369521
View PSSM: pfam07791
Aligned: 4 rows
Threshold Bit Score: 161.164
Threshold Setting Gi: 146196487
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8PA65        11 KGEFFHLQPDVRRGGKGHGVVFENRDALL--------TPPRLILKPKDGGFPALREIPRLVYHPSEG------VLPEDLE 76  Xanthomonas cam...
Q8PA69        37 AGSFYMFEADMESNRQPCGVRFDNVRHLL--------SPPRLILRPEEGGFPTLRETPQLTYDPKTG------PAPRDLE 102 Xanthomonas cam...
WP_011793716   9 KGEFYTLRPDLRGGGPGHGVVFENEKALR--------PPGRGMIRPPHGGFPPLREIPKLRYDSREG------LMPSDME 74  Acidovorax citr...
CAL80514      12 prKYFALKPDFNATAKAPGHQWLNRTEQMvgfyphpdQPFRGI---------RFSKPPRIRFDRKRGrttlrdAAPFALS 82  Bradyrhizobium ...
Q8PA65        77 GGFSGYWLVSERLRRVMETVDPAAFAFADTDYRLAD-GSKGPNVYLCDVVRTVDALDE 133 Xanthomonas campestris pv. campestris
Q8PA69       103 PGFSGYWLVSERLYDAMVLVDSDAFAFAEVDYRLAD-GTKGPRHFLCDIVRELDALGE 159 Xanthomonas campestris pv. campestris
WP_011793716  75 SGFSGYWLVSAALKEVFESVDAGGFAFQPCEFTLED-GSQGPDYFLCDVVRTLDALDE 131 Acidovorax citrulli
CAL80514      83 S-----WLITDRLKLLFERLDPEAFVFQKVEVDYSNfPEAGPDYWLVYFMRMLDCVDE 135 Bradyrhizobium sp. ORS 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap