Conserved Protein Domain Family
DUF1627

?
pfam07789: DUF1627 
Protein of unknown function (DUF1627)
This is a group of sequences found in hypothetical proteins predicted to be expressed in a number of bacterial species. The region in question is approximately 150 amino acid residues long.
Statistics
?
PSSM-Id: 369520
View PSSM: pfam07789
Aligned: 3 rows
Threshold Bit Score: 305.029
Threshold Setting Gi: 81765448
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nankaitd:CDCO157_2045  82 IEHHGPQTADELALMFGITSRRANSSLAMAISKGRLIRVNQGGKFRYCIPGADLPAEPKAASITETDGKAFPQPAGVALP 161 Escher...
Q8X8R9                105 IEQRGPQTADELATLFGTTSRKVASTLAMAISKGRLIRVNQNGKFRYCIPGDNLPAEPKAASVAETDGKAFPQPTGVALP 184 Escher...
Q8XAE0                 57 IGQDGAKTCEELAGKFGVSTRKVASTLAVVTATGRLARVNQNGKFRYCMSGGNLPADPKAAPVTKNDGKAFPQPAGAALP 136 Escher...
nankaitd:CDCO157_2045 162 VGEAETQEEIKTESVAVTVQSQPSFTRKHPDGLILPSLHVANRELRRAKGQVQKWERVCAALRELNKCRDILRDI 236 Escherichia...
Q8X8R9                185 VQEAATQEDIKTETVADIVQSLPSFTETRADDLVLPSLHMANRELRRAKNHVQKWERVCAALRELNKHRDIVRQI 259 Escherichia...
Q8XAE0                137 VREAATQEEIKTETVADIVQPLPSFTETQADELIFPSLRRANLALRRAKSDVQKWERVCAALRELNKHRDIVRQI 211 Escherichia...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap