Conserved Protein Domain Family
PDDEXK_10

?
pfam07788: PDDEXK_10 
PD-(D/E)XK nuclease superfamily
This family is found to carry modified motifs characteristic of PD-(D/E)XK endonuclease superfamily. These are the conserved Glu of motif I, the Asp surreounded by hydrophobics of motif II, EIKS of motif III, and the lysine of mmotif IV has migrated to an alpha-helix following the third core beta-strand. The conserved patch of positively charged lysine and arginine residues in the motif IV apha-helix might be involved in substrate-binding or be contributing to active site formation. Members with an additional N-terminal coi9led-coil domain, are annotated as tropomyosin, coiled-coil or microtubule binding proteins.
Statistics
?
PSSM-Id: 369519
View PSSM: pfam07788
Aligned: 14 rows
Threshold Bit Score: 79.6908
Threshold Setting Gi: 119525454
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q96ZS4        210 SEVEIDVVLSDGKVILVELTASLKRGELIQISRKRELYEKLKGKKVSEVIVVTPFIDDKNEERVIAIANSLGIK 283 Sulfurisphaera tokodaii
WP_011955315  261 DQIELDLIIKNGLLIICEIKSSVSKADVYAFERKARWYEQRHARQADRLMIISPMIDAR----AREAARRLQID 330 Roseiflexus sp. RS-1
Q9YCN7        281 SIVEVDVVVKDGQHVLVEIKSQVTQADVAEMHRIGLLYERAEGVK-PRLVIVGGFVDER----ARALAERLGVE 349 Aeropyrum pernix
jgi:Tpen_1429  49 SEVEVDLVVRDREHILVEVKSRVSRGDVAELYRVGLLYEKLYGVK-PRLVLVGGFIDTD----AWETAGALGVA 117 Thermofilum pendens ...
jgi:Tpen_1359 171 AMVEVDVAVKDGEHILIEVKSSVSRGDVAVFRRIGELYEKVNRVK-PRLIMVSPYVDPR----ALEDARILGVE 239 Thermofilum pendens ...
WP_014126307  240 SEVDYDVVVRDGRLIIVEIMSSLKRSDLPTIVKKRELYERARGAKVAAVYVVTPYIDDRYPERVKAMAKDLGLE 313 Thermoproteus tenax
Q970J3        183 SDIEYDIIVKDGNVILIEITSSLKRGDLPIIKRKKELYEKVKNVKITLVYVITPFVHDRYPERVKAMAKDMGIE 256 Sulfurisphaera tokodaii
Q97YH9        141 SDVEYDLMIEDGNLVMIEITSAIKRGDLPVIRKKKEFYERNKNVKISKVIVITPFLHDKYPDRLKAMAKDMGIE 214 Saccharolobus solfat...
Q97UQ7        162 SDVEYDIVVKDSSVILVEITSSIRRGDLPTIKKKKEFYEKVKNIKVNLVYVITPFIHDRYPERIKAMAKDMGIE 235 Saccharolobus solfat...
Q4J7T4        188 SDVEIDVVLKNGKVIMIEISSGIRRGDVGVILKKKEFYEKAKGVKVDEVIVITSIIEDRDPDRVKARAESLGIK 261 Sulfolobus acidocald...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap