5ZVS


Conserved Protein Domain Family
Reovirus_Mu2

?
pfam07781: Reovirus_Mu2 
Click on image for an interactive view with Cn3D
Reovirus minor core protein Mu-2
This family represents the Reovirus core protein Mu-2. Mu-2 is a microtubule associated protein and is thought to play a key role in the formation and structural organisation of reovirus inclusion bodies.
Statistics
?
PSSM-Id: 369516
View PSSM: pfam07781
Aligned: 4 rows
Threshold Bit Score: 978.317
Threshold Setting Gi: 138717
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZVS_4   1 MITIVVIPTahfswtdtnflnsVDYRLTSQPKIRDRFAVYAPG-----------WLRRQLDEFSASLTASELLQALQTIP 69 
Q00335   1 MAYIAVPAV-------------VDSRSSEAIGLLESFGVDAGAdandvsyqdhdYVLDQLQYMLDGYEAGDVIDALVHKN 67  Mammalian orthoreovir...
Q8JU58   1 MITIVVIPTahfswtdtnflnsVDYRLTSQPKIRDRFAVYAPG-----------WLRRQLDEFSASLTASELLQALQTIP 69  Golden shiner reovirus
B2BNE3   1 MITIVVIPTerfpwtdtnllnsIDYRLNNIPKSNQRFAVYAPA-----------WLRLQLEEAAVSLTPSQLLAAIQDIH 69  American grass carp r...
5ZVS_4  70 IPVKARCLLLPKPKRFAQWLLDVPSAniwhIPVTTLR------------------ATVASKHPSSDVYNYIpdhVPPNAE 131
Q00335  68 WLHHSVYCLLPPKSQLLEYWKSNPSV----IPDNVDRrlrkrlmlkkdlrkddeyNQLARAFKISDVYAPL---ISSTTS 140 Mammalian orthoreovir...
Q8JU58  70 IPVKARCLLLPKPKRFAQWLLDVPSAniwhIPVTTLR------------------ATVASKHPSSDVYNYIpdhVPPSAE 131 Golden shiner reovirus
B2BNE3  70 VPVTSTFALLPKAKRFAQWLLDDPSSniwhIPVTVLN------------------VTATSKHPTSDIFNYVvghVSPNAE 131 American grass carp r...
5ZVS_4 132 FDTVTRRVAAGRDIYVRSTKVIGAPLCLAAPAKYYAGYLSTHQLDGIYPENWAPDNFHKREFCLTILPSLLGPRTFLLD- 210
Q00335 141 PMTMIQNLNQGEIVYTTTDRVIGARILLYAPRKYYASTLSFTMTKCIIPFGKEVGRVPHSRFNVGTFPSIATPKCFVMSg 220 Mammalian orthoreovir...
Q8JU58 132 FDTVTRRVAAGRDIYVRSTKVLGAPLCLAAPAKYYAGYLSTHQLDGVYPDNWAPDNFHKREFCLTILPSLLGPRTFLLD- 210 Golden shiner reovirus
B2BNE3 132 LATTASRVSGTQVVYTRTSKVLGAPLRLAAPTSYYSGYLSSQQLSHVYPSSWTPETFKKKEICFTILPSLTSPKTFLLD- 210 American grass carp r...
5ZVS_4 211 VDADrdaSYP------------------LSVLWPQLRALALKSRLLlppvallrRVVDPGLKptwsadsdaafRALRLSR 272
Q00335 221 VDIE---SIPnefiklfyqrvksvhaniLNDISPQIVSDMINRKRL--------RVHTPSDR-----------RAAQLMH 278 Mammalian orthoreovir...
Q8JU58 211 VDADrdaSYP------------------LSVLWPQLRVLALKSRLLlppvallrRVVDPGLKptwsadsdaafRALRLSR 272 Golden shiner reovirus
B2BNE3 211 VDAPrdpSFP------------------LSVMWPLLRNDAVKSHRLmppnallrRTVDPALKpewsadvdpsfRALRLSR 272 American grass carp r...
5ZVS_4 273 -PSSASKPVGF-DFSALPVVDIicLLESEPDDHGRIAPGTRLTIHSVPTDLLTSLSIQEGvRYPLRQESGMFVHWVLLAL 350
Q00335 279 lPYHVKRGASHvDVYKVDVVDV--LLEVVDVADGLRNVSRKLTMHTVPVCILEMLGIEIA-DYCIRQEDGMFTDWFLLLT 355 Mammalian orthoreovir...
Q8JU58 273 -PSSASKPTGF-DFSALPVVDIicLFESEPDDHGRVAPGTRLTIHSVPTDLLTSLSIQEGvRYPLRQESGMFVPWVLLAL 350 Golden shiner reovirus
B2BNE3 273 -PRGANTSSCH-NRHHVPVCDIqcALTPEPLNDSEKPPATHITIHAVPSDLLTVLDITVGkEYPLRLESGMYVPWMLMSL 350 American grass carp r...
5ZVS_4 351 LMSDDVTISGTRRSVKLETAHASARPFVHITVERCASARIIDVRGSPAMYANAVCLTLPKGSYKSTIIDTLPAM-FSDLP 429
Q00335 356 MLSDGLTDRRTHCQYLINPSSVPPDVILNISITGFINRHTIDVMPDIYDFVKPIGAVLPKGSFKSTIMRVLDSIsILGVQ 435 Mammalian orthoreovir...
Q8JU58 351 LMSDDVTISGTRRSVKLETAHASARPFVHITVERCASARVVDVRGSPAMYANAVCLTLPKGSYKSTIIDTLPAM-FSDLS 429 Golden shiner reovirus
B2BNE3 351 LMSDDVTLTGTRRSVKLETAHAAQRPFTQVKILRCVSARVTSVRAGPATYLNAVCLTLPKGSFKSTMIDTLPSL-FPEWP 429 American grass carp r...
5ZVS_4 430 ILEQAAVIDSDALGDSLRPSFETQFLERLENLDP-NLLDRAVASILSPTSDTSDDAVTTVLDAFNALYREIMTPAQRARL 508
Q00335 436 IMPRAHVVDSDEVGEQMEPTFEHAVMEIYKGIAGvDSLDDLIKWVLNSDLIPHDDRLGQLFQAFLPLAKDLLAPMARKFY 515 Mammalian orthoreovir...
Q8JU58 430 ILEQAAVIDSDALGDSLRPSFETQFLERLENLDP-KLLDRAVASILSPASDTSDDAVTTVLDVFNALYREVMTPAQRSRL 508 Golden shiner reovirus
B2BNE3 430 VVSTTAIVDSDHLGDSLDPTFEQRFATMLETLPP-GTVDQAIRVALATCPTADETALQLIVTSFNELYASCMTEAQRNRV 508 American grass carp r...
5ZVS_4 509 PLLTQQGRVLAFAHSDYELLSANIPIQVVRGSIPIDHVVNLLARRNRVGGTALQVLLDYCYRTQASPLAPTPAGRLYKQL 588
Q00335 516 DNSMSEGRLLTFAHADSELLNANYFGHLLRLKIPYITEVNLMIRKNREGGELFQLVLSYLYKMYATSAQPKWFGSLLRLL 595 Mammalian orthoreovir...
Q8JU58 509 PLLTQQGRVLAFAHSDYELLSANIPIQVVRGSIPIDHVVNLLARRNRVGGTALQVLLDYCYRTQASPLAPTPAGRLYKQL 588 Golden shiner reovirus
B2BNE3 509 PILTQQGRTLVFAHSDYEMLAANVPIQVIRGAIPIDHTVNIIARPNRVGGTALQLLLDYCYRMQASPIATMPAGALYRQL 588 American grass carp r...
5ZVS_4 589 FGPWLMVPrlsepliklRLVASA-PAKVLRAAGWTI--------------DGDPPlevsclcaYVTDRA---AATALIER 650
Q00335 596 ICPWLHME---------KLIGEAdPASTSAEIGWHIpreqlmqdgwcgceDGFIP--------YVSIRAprlVMEELMEK 658 Mammalian orthoreovir...
Q8JU58 589 FGPWLMVPrlsdpliklRLVASA-PAKVLRAAGWTI--------------DGDPPlevsclcaYVTDRA---MAAALIER 650 Golden shiner reovirus
B2BNE3 589 FGPWLRAKadceqltpvSLIAEV-PARVMRAAGWTI--------------QDDMPliinvmrcYRNVDD---QIDDVLTR 650 American grass carp r...
5ZVS_4 651 RLDSRALVTVGGDQLMFVEyaP--------------PLPLVSIPRTFLLPVTYVVHWVPPQRvllNGGNVSFTSGLEWTf 716
Q00335 659 NWGQYHAQVIVTDQLVVGE--PrrvsakavikgnhlPVKLVSRFACFTLTAKYEMRLSCGHS---TGRGAAYNARLAFR- 732 Mammalian orthoreovir...
Q8JU58 651 RLDSRALVNVGGDQLMFVEyaP--------------PLPLVSIPRTFLLPVTYVVHWVSPQRvllNGGNVSFTSGLEWTf 716 Golden shiner reovirus
B2BNE3 651 TETSRAIITISADGIILVEyaP--------------PLPLITLPSSILLPATYTATWLEPPRillTGSNVSVTSGLSWAe 716 American grass carp r...
5ZVS_4 717 dddpqvvtstG 727
Q00335 733 ----------S 733 Mammalian orthoreovirus 1 Lang
Q8JU58 717 dddpqvvtstG 727 Golden shiner reovirus
B2BNE3 717 vgspldvpppG 727 American grass carp reovirus PB01-155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap