Conserved Protein Domain Family
PsiF_repeat

?
pfam07769: PsiF_repeat 
psiF repeat
This region is approximately 35 residues long. It is found repeated in a number of putative phosphate starvation- inducible proteins expressed by various bacterial species. psiF is known to be an example of such phosphate starvation-inducible proteins.
Statistics
?
PSSM-Id: 400224
View PSSM: pfam07769
Aligned: 57 rows
Threshold Bit Score: 34.9778
Threshold Setting Gi: 490771170
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q88DH4               71 PQTQQEKMKTCNADATTKALKGDERKAFMSDCLK 104 Pseudomonas putida KT2440
WP_004633396         80 PMTQQEKMAACSKANKGK--KGDEYKNAQKACLS 111 Ralstonia
WP_013200980         25 KTAQQQKMTVCNQQAGEKTLKGDERKTFMSNCLK 58  Erwinia billingiae
goetting:EBL_c29400  27 LTEQQQRMQSCSQQAGAKTLKGDERKSFMSSCLK 60  Shimwellia blattae DSM 4481 = NBRC 105725
WP_014403740         29 LTAQQQRMATCAKESTGK--KGAEHRAFMSSCLK 60  Frateuria aurantia
wugsc:KPN_00328      64 LTPQQQKMSDCSKAATAKSLKGDERSTFMSSCLK 97  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
jgi:Pnap_3700        42 KTGQQSKMATCNKEATGK--KGDERKAFMKECLS 73  Polaromonas naphthalenivorans CJ2
jgi:Daci_2268        40 PTAQQKLMGTCNTEATGK--KGDERKEFMKSCLS 71  Delftia acidovorans SPH-1
SYS96848             26 PTPQQQRMTDCNQQASAKMLKGEERKTFMSQCLK 59  Klebsiella pneumoniae
WP_013200980         66 mTPQQMKMKTCNTQAGEKMLKGDERKTYMSSCLK 99  Erwinia billingiae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap