Conserved Protein Domain Family
DUF1615

?
pfam07759: DUF1615 
Protein of unknown function (DUF1615)
This is a family of proteins of unknown function expressed by various bacterial species. Some members of this family are thought to be lipoproteins. Another member of this family is thought to be involved in photosynthesis.
Statistics
?
PSSM-Id: 400217
View PSSM: pfam07759
Aligned: 31 rows
Threshold Bit Score: 425.891
Threshold Setting Gi: 122309874
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6F9E1         52 RVHDRQSWANDINDIMEKLKIPKTKDNVCSVVAIVDQESNFVANPVVAGLGEKAVKEVSTRLNEKfeeklgttiggQVAG 131 Acinetobacter ...
Q09DU8         54 GVKDREGWAQAVLDALEAQKIAPTVEPICQVLAVIEQESGFQANPGVKDLPRIVRRRLDAYAGKL-----------GVIG 122 Stigmatella au...
WP_014393530   54 kgAEREGWAGDVLAALDAEAIPAAASEVCQVLAIIEQESGFQADPAVPGLPKMVRQKLDSTAGRL-----------GPVG 122 Corallococcus ...
Q1DE66         41 QLQDREGWARDVLAALEVEEIAPSPPAVCSVLAVIEQESGYKVDPAVAGLPKMVRTRLEEHANKL-----------GPLG 109 Myxococcus xan...
WP_003668774   44 RVNNAKLWATDIGDIFDELSLPKTAQNICTAIAVIDQESNFHADPSVPNLGNAALKAIDDKLEDKlg--------kNMAG 115 Moraxella cata...
WP_025330618   60 RVKERDAWAVDISRIMDELKINKTQENVCSVIAVVDQESNFVANPTVPDLGNKAIKAFQTEVPQKfvrqfgpalgpAVSR 139 Snodgrassella ...
Q7NXF4        106 GIPDRKGWSNDVMGAFSHLKIPYTPQFFCAVLAVAEQESGFSPDPVVPNLSKIVWGEIEQRRQKY-----------LIPQ 174 Chromobacteriu...
Q7NSQ7         81 GARDRQGWIADIDGAFRHLQIPATADNACALAAVIEQESSWQADPVVPGLPKIVWGKIEERAHRY-----------LVPL 149 Chromobacteriu...
WP_014088248   97 KIRDRAGWAEDIFDAFTALKLPYTAENFCAAAAVIEQESSWQSDPTVPGLPKIVWGKIGEKAAGY-----------HIPL 165 Pseudogulbenki...
jgi:Galf_2301  96 RLKDKAGWADDLQSAYKALQIPPTPEYFCATLAVIEQESSFQADPVVLGLPAIIRREIVQRSEKY-----------SIPQ 164 Gallionella ca...
Q6F9E1        132 YFEDVLKNQPTPD---DNYMSQMRRVRTEKDLDVLYRQIFDYMashyhvs--altgaakLVGQDIAEKMNPITTLGSMQV 206 Acinetobacter ...
Q09DU8        123 RSALKALLQHKAPgesRTFEKRLKGVRTEQDLDRFFRDLLEAYerhypafysaadlaseLFTSKRLAELNPITTAGSMQV 202 Stigmatella au...
WP_014393530  123 RRLLGDVLAAKPKgakRTFGARLDTLRTERDLDRLFRDMLAYYeeeypaayaaadlassLFGPSSFAGQNPVTTAGSMQV 202 Corallococcus ...
Q1DE66        110 RKVLASVLEGRAKgskKTFDERLRALRTERDLDRLFRDMLAYYenefpsafkvvdfasgVFASGNLHEFNPVTTAGSMQV 189 Myxococcus xan...
WP_003668774  116 VFRNMLETRPTPK---NNFIKQIKAVKTEKQLDELYREIFDYFtrtykia--pltnitkLSGQGIDERINPVTTLGSMQV 190 Moraxella cata...
WP_025330618  140 YFTSVLVNEPSKE---NSFLIQMRTVKTEQQLDLIYRQIFAYVskqfyads-itnaaakFMGKDIGEDNNPITTIGSMQV 215 Snodgrassella ...
Q7NXF4        175 FVVDAAMGKKSPDg--RTFKQRVDALRTKREMNALYEDMVREL----------------PFGQTIFEHKNPIRDGGPMQV 236 Chromobacteriu...
Q7NSQ7        150 TVVKGALLKTSPNg--QSYKTRIDNLRTEREMNLLYEDMSREAq---------------KLGLPM-EMKNPIRTGGPMQV 211 Chromobacteriu...
WP_014088248  166 PLVKTALLKPSPNg--RSYKERIDTLRTEKQMNELYEDMSAEAe---------------KIGFPTIMKKNPIRTGGPMQV 228 Pseudogulbenki...
jgi:Galf_2301 165 TVIDWMLSSNSRDg--RSFSQRIDALKTEKELSDLIEEIIAML----------------PAGRELFPNYNPVHTGGPMQV 226 Gallionella ca...
Q6F9E1        207 NIVYAKENKRvkLQSVNN---LRDDLYTQYGGLYYGIHRLMLYQTSYDKPIYRFADYNSGMYSSRNAALQSMLNKLGDEQ 283 Acinetobacter ...
Q09DU8        203 SVRYAVEQDDgeHSEQE----VREQLYTRAGGVHHGTSRLLGYPAGYPQPVFRFADYNAGFYASRNAALQAQLSRLTGRR 278 Stigmatella au...
WP_014393530  203 SVRYAVEKAGpdADPVA----VRESLYTRAGGVRYGTARLLGFEAAYDAPLYRFADYNSGVYSSRNAALQAQVSRLTGVA 278 Corallococcus ...
Q1DE66        190 SVRYAMQKAGedADPAE----VRESMYTRAGGVRYGTARLLGYEAAYPEPLFRFADYNAGVYASRNAALQSQVSRLTGHP 265 Myxococcus xan...
WP_003668774  191 HIDYARAHRRasMSDRD----LRADLYTRYGGLYYGIHRLMVYQANYDKPLYRFADYNSGMYSSRNAAFQQRIATLSGES 266 Moraxella cata...
WP_025330618  216 SVKYAREHQRd-NAPVNE---LRDYMYTREGGLYYGIHRLMKYPAAYDNAQYRFADYNSGMYSSRNAAFQQDINKLLNTD 291 Snodgrassella ...
Q7NXF4        237 SVAFAETHIRawPYPYNys-sLRDEVFGRRGSVYFGTAILLQYPAPYHEMVYRFADYNAGRYASRNAAFQLAVSRLSGRK 315 Chromobacteriu...
Q7NSQ7        212 SVEFAEGHARvwPYPYPVqgsIRHEVFSRRGGVYFGAAILLQYPAPYRDMLYRFADFNAGRYSSRNAAFQAALSRLSGRK 291 Chromobacteriu...
WP_014088248  229 SVEFAEAHVRawPYPYSRktsLRNEVFSRRGGVYFGSAILLQYPAPYKDMLYRFADFNAGRYSSRNAAFQAVISRLSGRR 308 Pseudogulbenki...
jgi:Galf_2301 227 SVEFAESHVRarPYPYPLhgnLRNEVFSRRGGVYFGSAILLDYPAPYTDMLYRFADFNAGRYSSRNAAFQRALSRASGQP 306 Gallionella ca...
Q6F9E1        284 LTEDGDLLLYNkd----gSiqSTRSSSEKALIKIFTLNn-vLLTPNQIRTDLKQEKSQSFEQTPTYIAITKLYQKQTGKE 358 Acinetobacter ...
Q09DU8        279 LLLDGDLLLYNdq----gKprDEDSQSLSALLAFRQRHa-pKLSERQLRKDVRKEKEASFEKTETWRALKQAYERVTGER 353 Stigmatella au...
WP_014393530  279 LATDGDLQLYDkd----gEprGEDSQSLKALLLFRERYa-pDLSERRVRRDVKEEKTADLEKTDTYLAVKRVYANRMGQA 353 Corallococcus ...
Q1DE66        266 LAPDGDLQLYDkq----gQprSEDSKSLLALLAFRQRFapeELSERQVRRDVRKEKEPDFESTDTFRAVKRVYQRETGES 341 Myxococcus xan...
WP_003668774  267 LAIDGDLLLYKd-----gSpiSKISSTETAAIALLATAs-kPINAQQIRSDFKKEKTRDFEKTITYRAVNDMFASKFGRE 340 Moraxella cata...
WP_025330618  292 MALDGDLLLYDkd----dKaqSMPSQTETALNQLFADHg-mPMKPEQIRADLLQEKQAEFENTSTYQNVITLYKQQFGKN 366 Snodgrassella ...
Q7NXF4        316 LALDGDIMLYSdkmnrvlS--GETSDTQRALQSIAGRL---GISDADMMRDLRLEKLSGFGQSPLYQKVFALA----GPK 386 Chromobacteriu...
Q7NSQ7        292 LALDGDLLNYQ-------G--KAASGSQQAALSLAGRL---GMSAAAIQRDLQLEKNAAFGQTPLYRQVFALADKQAGQA 359 Chromobacteriu...
WP_014088248  309 LARDGDLLSYEn-----gQ--ASGGSTLNALQALDNRL---GMSDNAIMRDLKQEKLATFGQTELYRKVYALADPLYGGQ 378 Pseudogulbenki...
jgi:Galf_2301 307 LAPDGDLLRYKng---npS--TDASATLKALLTLNRTL---KLSEAELQRDLRLEKLSSFSRTPLYQRLYALADQ--NGT 376 Gallionella ca...
Q6F9E1        359 APYAMMPQVIISGPKLSRDYNTNWYASRVNGRYQTCMQR 397 Acinetobacter baylyi
Q09DU8        354 PAYARLPEVTLQSPKLSRERTTAWFAHSVDQRFQRCLAR 392 Stigmatella aurantiaca DW4/3-1
WP_014393530  354 PAYAQLPQVTLKSVKLSGERSTAWFAKSVDARYQQCMAR 392 Corallococcus coralloides
Q1DE66        342 PSYAQLPRVTLQSPKLKRELTTAWFARSVDQRFQKCMTR 380 Myxococcus xanthus DK 1622
WP_003668774  341 PTYAIMPKVVISGPKLSRDFDTNWFATRVNERYQTCITt 379 Moraxella catarrhalis
WP_025330618  367 PPYAIMPQVVISGPKLSKDYNTNWYATNVTRRYETCM-R 404 Snodgrassella alvi
Q7NXF4        387 APREIIPQIVLVSPKFTHKLTTEWFARRVDGRYQRCLQR 425 Chromobacterium violaceum
Q7NSQ7        360 QPRERMPQIDLKSPKISRKLTTEWFAKRVDGRYRQCLAR 398 Chromobacterium violaceum
WP_014088248  379 APREQLPQIDLKSPKITRKLTTEWFAERVNGRYQTCLQR 417 Pseudogulbenkiania sp. NH8B
jgi:Galf_2301 377 QPRVALPQIDLKSPKIKRKLTTEWFANRVNSRYKNCLQq 415 Gallionella capsiferriformans ES-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap