Conserved Protein Domain Family
RVT_2

?
pfam07727: RVT_2 
Reverse transcriptase (RNA-dependent DNA polymerase)
A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. This Pfam entry includes reverse transcriptases not recognized by the pfam00078 model.
Statistics
?
PSSM-Id: 400190
View PSSM: pfam07727
Aligned: 3 rows
Threshold Bit Score: 415.837
Threshold Setting Gi: 199430760
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2R072        916 KTWRLVDLPSGHRPIGLKWVYKLKKDAQgVVVKHKARLVAKGYVQRAGIDFD--EVFAPVARLDSVRLLLALAAQEGWMV 993  Japanese rice
CAR65566     1170 EVYTVVKNPKNVKPIPTTWVHTHKINDL-KEVQYKSRCVVQGFRQIANEHYDtsKVSSPVIELSIIRLLTAIAVEYEWPI 1248 Debaryomyces ...
XP_002770268 1022 NTWDLVSLPKDRKAIGNRWVFTKKD-----DGRYKARLVAQGFSQVPGEDYL--DTFSPVIRYESVKLLLAFSAVDNRVV 1094 Debaryomyces ...
Q2R072        994 HHMDVKSAFLNGELIEE--VYVVQPPGFEIDgqENKVYRLDKALYGLRQAPRAWNTKLDCTLKKLGFKQSPLEHGLYARG 1071 Japanese rice
CAR65566     1249 HHLDISSAYLHADIDYEksIFVKPPPGSNID--SGKCWQLNKSVYGMKQAGYMWYQCITKVLMDLNFEPDTAISGMFCKY 1326 Debaryomyces ...
XP_002770268 1095 HQMDVDTAFLNGTVEET--LYMKQPVGFINEnePEKVCKLNKSLYGLKQAPICWNTTISDFLAEHRFNRIDTELGIYVRG 1172 Debaryomyces ...
Q2R072       1072 DGSGR-LLVGVYVDDLVIVGGDSGMIKGFKEQMKAEFKMSDLGPLSFYLGIEVHQEAGIITLKQAAYASRIVEKAGLTGC 1150 Japanese rice
CAR65566     1327 FGENKkLIVALYVDDMFLTSSNITILNDFKLELAKHFDLKYFADISEFLGIEFIQIAGGYRLSQHNFLNSVIKKFNLTNN 1406 Debaryomyces ...
XP_002770268 1173 ----N-IIIGLYVDDILISGKDMKEIEDVKKMLASKFKMKDLGVAKKFLGINIAQDTNGIKICLYDYIGKVLQDFEMTDA 1247 Debaryomyces ...
Q2R072       1151 NPCATPME 1158 Japanese rice
CAR65566     1407 YGKYIPII 1414 Debaryomyces hansenii CBS767
XP_002770268 1248 NTVTTPTl 1255 Debaryomyces hansenii CBS767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap