6I2M


Conserved Protein Domain Family
BACK

?
pfam07707: BACK 
Click on image for an interactive view with Cn3D
BTB And C-terminal Kelch
This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).
Statistics
?
PSSM-Id: 400174
View PSSM: pfam07707
Aligned: 69 rows
Threshold Bit Score: 67.1832
Threshold Setting Gi: 74804852
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6I2M_A 123 CIDFYIYADKYNNKKIESASFNTILQNILRLINDENFKY-LTEESMIKILSDDMLNIKNEDFAPLILIKWLESTQQ--SC 199 Vaccinia virus WR
Q8C726 142 vCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLASDGFLS-LSKTALLNIVLRDSF-AAPEKDIFLALLNWCKHNAk--EN 217 house mouse
O16313 170 LCSIFNAAYFFQFTDLIDYCMQYSDKHADQLLEDPSFNR-LSGDSLKELLARDSF-FALELKIFNAVRSWHQNNPTmkEA 247 Caenorhabditis elegans
Q7QI84 148 VCAILDAARLFALDGLTAVCHSFMDRNAADILQHESFRH-LSLDSLCSLLLRDSF-FAREVEIFQAVFDWCRCNADtvPN 225 Anopheles gambiae str...
Q9W2S3 150 VCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNT-LSKESLEEVLRRDCF-FAPEVQIFLAVWKWSRFNSN--VD 225 fruit fly
Q8N4N3 148 YLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPDFLQnVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEreAH 227 human
Q8BGY4 156 CLHIGQMATTFSLTSLRESVDAFTFRHFLQIAAEEDFLR-LPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPArrAR 234 house mouse
Q66IL9 176 CVEVGRIANTYNLTEVDKYVNNYILKNFPALLTTGEFVK-LPFDRLAFVLSSNSLKQCTELELFKAACRWLRYEDArmEY 254 tropical clawed frog
Q6Q7X9 173 CMYVVNIADTYNLKETKEAAQKFMRENFIEFSEMEQFLK-LTYEQINEFLTDDSLQLPSELTAFQIAVKWLDFDEKrlKY 251 zebrafish
Q8BWA5 172 CMYVVNIAETYSLKNAKATAQKFIRDNFIEFAESEQFMK-LTFEQINELLVDDDLQLPSELVAFQIAMKWLEFDQKrvKH 250 house mouse
6I2M_A 200 TVELLRCLRISLLSPQVIKS 219 Vaccinia virus WR
Q8C726 218 HAEIMQAVRLPLMSLTELLN 237 house mouse
O16313 248 SKVLLELVRLPLITQTELLN 267 Caenorhabditis elegans
Q7QI84 226 VDVVVGKVRFELMSLEELLT 245 Anopheles gambiae str. PEST
Q9W2S3 226 FKSVVSYVRLPLMNLEHLLQ 245 fruit fly
Q8N4N3 228 ARQVLENIHFPLIPKNDLLH 247 human
Q8BGY4 235 ASLVLRHVRFPLMQPAELVD 254 house mouse
Q66IL9 255 AAKIMKNIRFPLMTPQDLIN 274 tropical clawed frog
Q6Q7X9 252 APDLLSNIRFGTITPQDLVS 271 zebrafish
Q8BWA5 251 AADLLSNIRFGTISAQDLVN 270 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap