3IDU,2L0D


Conserved Protein Domain Family
CARDB

?
pfam07705: CARDB 
Click on image for an interactive view with Cn3D
CARDB
Cell adhesion related domain found in bacteria.
Statistics
?
PSSM-Id: 400172
View PSSM: pfam07705
Aligned: 42 rows
Threshold Bit Score: 65.3762
Threshold Setting Gi: 81539242
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IDU_A   16 FPDLTV-----EIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLY---KNWTV-SLGPKEEKVLTFNWTPt- 85   Pyrococcus furiosus
Q8TQ02  385 LAVFIIaa-fsGCVEETQTVEKTAYSIPLKITNSGEASALDFDVTLYLDGESV---TVLKIpELEGQTSIEDRIRVQT-- 458  Methanosarcina acet...
Q8TQ02  234 LPDLYPe----MKIPEQELVDEKTAEISFTINNPGGICEENCTVSFRVDGTEVltsSa----LMDASGVYRSSFSWPA-- 303  Methanosarcina acet...
Q8TPZ3  310 TSDLIV-----SGLTVPLLYAGKDNTIKASIKNIGKDSAYGFQAALYADGEIV---STAPVsSLSSGKSKTIEFNWKPa- 380  Methanosarcina acet...
Q8TPY9  671 RPDLIVs----SIIPPSSITANTSCNIGATISNTGESDAGTFNATLSVNGAVV---DTHAVsGIVSGSSATVNFSWKPv- 742  Methanosarcina acet...
Q8TPY5  349 SADLGIqdvkvSHNGLAKAWNKLNNTVSVTVINNGPENADSFALELYSDGTPV---ESRQVtGLANGATETVDFSWKPe- 424  Methanosarcina acet...
Q8THC8  259 IPDLVP-----TSLTPSYVTPGTVNTMTATIENT-DKDSPSFNVSLIADGTVV---DTQDVsGIAAGGSTTVDLQWTPe- 328  Methanosarcina acet...
Q8TM75  262 KTDLVP-----VNLTPNVVVPNTENTLTATIENQGDKNSTAFNTSLLVDGTVV---DTQTVtNLASKSSTNVDFHWTPdg 333  Methanosarcina acet...
2L0D_A    2 IPDLVP-----VSLTPVTVVPNTVNTMTATIENQGNKDSTSFNVSLLVDGIVV---DTQTVtSLESENSTNVDFHWTLdg 73   Methanosarcina acet...
O26810   91 LPDLICk----STELVADLIVNETYTFTARISNIGPANASGVRVDFVDNGVRV---GSYTIpLLRSGETTTVVFNWTPm- 162  Methanothermobacter...
3IDU_A   86 QEGXYR-INATVDEENTVVELNENNNVATF 114  Pyrococcus furiosus
Q8TQ02  459 LKGEHT-LSVKVDEHNDIVESDEDNNGFEE 487  Methanosarcina acetivorans
Q8TQ02  304 VEGEHL-LELAVDSEAKIKESDEENNVCAL 332  Methanosarcina acetivorans
Q8TPZ3  381 WDGEQA-LKVYVDYTNKKKETCEVNNWNSP 409  Methanosarcina acetivorans
Q8TPY9  743 AAGYYS-VKVSADAGNVIAESDETNNELAD 771  Methanosarcina acetivorans
Q8TPY5  425 DIKDYT-LKAVVVPGSIISDTDTTNNELSK 453  Methanosarcina acetivorans
Q8THC8  329 GGKDSYsLTVVVDPDNSVVESEETNNELTV 358  Methanosarcina acetivorans
Q8TM75  334 TTTNSYtLTVNVDPENVVNEGNESNNTLTM 363  Methanosarcina acetivorans
2L0D_A   74 TANSYT-LTVNVDPENAVNEGNESNNTLTA 102  Methanosarcina acetivorans
O26810  163 TVGSHT-LQLIIDPENHIQEINKTNNKFNR 191  Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap