Conserved Protein Domain Family
5TM-5TMR_LYT

?
pfam07694: 5TM-5TMR_LYT 
5TMR of 5TMR-LYT
This entry represents the transmembrane region of the 5TM-LYT (5TM Receptors of the LytS-YhcK type).
Statistics
?
PSSM-Id: 400162
View PSSM: pfam07694
Aligned: 66 rows
Threshold Bit Score: 72.25
Threshold Setting Gi: 501338624
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012010843   25 VKGFRNL-L-LHNE-GFRK-KAVLVFIFASFSIISNYTGIEIqQqmvmnhefsyhlgSSs-SIANTRIMGIEMGGLIGGP 99  Bacillus pumilus
Q3J0V4          5 IALIYGS-VqRLGLsRRLR-HVLLGLAFGFGASVQMMQSIAV-A-------------PG--VIVDSRALFIGFAGAFLGP 66  Rhodobacter sp...
WP_012179584   22 GFAYSRVqRmMRH--PRGS-EAFLGAIFGLSAITQMLRPFEP-M-------------EG--LLIDLRNIPIALAGAFLGW 82  Dinoroseobacte...
WP_011529710   15 FTSIGSLtYtGREDyHTLR-RALRYLISVLAGIILVLYGVPL-M-------------EG--VRVDFRGVPILLAGLFGGP 77  Deinococcus ge...
Q9RYX3         21 VYLLSLTyKsAADLaDSRL-QVPRFLLVSLMCVPLMFFPAQV-A-------------PG--VFVDLRAVPIAFLTLRLGW 83  Deinococcus ra...
Q9RVD9         16 MYLLSLTyKsAEDItATAI-HVPRLLLLAVMAVVLMLYPAEV-A-------------PG--VIIDMRAVPIAYLALRKGV 78  Deinococcus ra...
Q5HQY3         16 IYLFHRLqYsENKR-MIFS-KEYVTVLMTFVSLLLAAYPIPFq---------------Ne-YLVHLTFVPLLFLGRYTNM 77  Staphylococcus...
WP_012370259   21 FYIISKIiHsTRFSsYAVK-SLIIGLATGLLGVVLMFKGIQV----------------NdsLRMDLRHLPLVLLAFYGNR 83  Exiguobacteriu...
jgi:Exig_0198  21 LFLPFRNhPrITPKtNLNV-RLVLGGIAGLISVLLMLNSIQId-----------------vARIDLRIVPVVIAMMFGGL 82  Exiguobacteriu...
WP_012370070   19 FYLLGKLsPhPITVdSKRSvRILYGLSLSILSLLLMQLTIEP-V-------------SG--VLVDLRHIPVIVAAYFAGP 82  Exiguobacteriu...
WP_012010843  100 FVGIGAGLLAGIHRYSLGG--STALSCAISSILAGVIAGYVGSRFKRKn----RMVTPRQAALFGVAMESLQMVIILLFA 173 Bacillus pumilus
Q3J0V4         67 LGATVALMVSLLLRISLVS--TAMPALAAGSMAASALMGSLWPVLRRRlglghFTGLVLLAVMISLP-----LVLLAWLP 139 Rhodobacter sp...
WP_012179584   83 RGAAACLAVTVATRLYVGG---VGMWAGALGMVLALAAGIYWARKTKGaerrgILALLSLALLMSAHLVA-------ALI 152 Dinoroseobacte...
WP_011529710   78 LPALAVALPIMAYRLWAGG--TGAHAGVLSILLVALCAGMLHARFAQNrltwrDAWVPFAIFALANL----------SIL 145 Deinococcus ge...
Q9RYX3         84 GWGLVGAVPLLVYRYLLGG--VGWPPAMVSAIGVVLVAGLFHGRLGLFrpqwpWERLLLPLLLIFLPNG--------LLL 153 Deinococcus ra...
Q9RVD9         79 WAGLLALIPLLLYRFHLGG--VGTWSAVFSAVGVVLLGGLLHRSVDLSaprldWRSLWWRLLLVFMPNG--------ILI 148 Deinococcus ra...
Q5HQY3         78 IYTLTAAFIVSLVDVFIFG---NSIIYGITLIVIAGIVSAVGPFLKQN-----DIISLLILNLISII-----ILLFLALL 144 Staphylococcus...
WP_012370259   84 FPLVVATLIIAGSRF-LFGvtPQAFIAFVSIIAISTGMIWIHRQLLNRpfrqnLALNVWALLMITFA----------VLI 152 Exiguobacteriu...
jgi:Exig_0198  83 PSALVTGAMIIVTRFILTP--VEQMDAAVVSTIVIGVLILTIAVVRRYirltfWNFELMIGIGIVYSLPGIY-----LLT 155 Exiguobacteriu...
WP_012370070   83 LPTCIVTAVIIVYRF-SVNtnAAAFAACLFILLVASGTSLIVRWLPLYsrktfTVVTVYATVLHGLVLT--------FVL 153 Exiguobacteriu...
WP_012010843  174 KPFADAWGLVSIIALPMIFVNGIGSFIFLSILQSV 208 Bacillus pumilus
Q3J0V4        140 VGRTDSLEVLAAIL---VLLNLTGALVFGTFLQRE 171 Rhodobacter sphaeroides 2.4.1
WP_012179584  153 LPEAARTLFLAQAALPIFLVNMIAMPIAASILERE 187 Dinoroseobacter shibae
WP_011529710  146 LVPSAGPQLLRTAWLPVTLLQGLATLVAFTVVSLR 180 Deinococcus geothermalis
Q9RYX3        154 PIIRHDLSLYLTVWLPLLVMCFLGALITLGILRSR 188 Deinococcus radiodurans
Q9RVD9        149 PVLRGDPAALLTVYLPLLVVTYAGFLVSLGIQRNR 183 Deinococcus radiodurans
Q5HQY3        145 SPIYELVEI--LVLIPISFIITIASAITFVDIWhf 177 Staphylococcus epidermidis RP62A
WP_012370259  153 NLGFNDASL--RLLLATWTIGLAVGVLSSMLTLDF 185 Exiguobacterium sibiricum
jgi:Exig_0198 156 NSWTTFIEI----SLAYIFFNLIAGFVTYHLLTEL 186 Exiguobacterium sibiricum 255-15
WP_012370070  154 FDTGLILDILSVVL----PASFASSWLALVIIRDI 184 Exiguobacterium sibiricum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap