2V6J


Conserved Protein Domain Family
Flavi_DEAD

?
pfam07652: Flavi_DEAD 
Click on image for an interactive view with Cn3D
Flavivirus DEAD domain
Statistics
?
PSSM-Id: 400138
View PSSM: pfam07652
Aligned: 19 rows
Threshold Bit Score: 227.604
Threshold Setting Gi: 74786485
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V6J_A       1 KRELTVLDLHPGAGKTRRVLPQLVREAVKKRLRTVILAPTRVVASETYEALRGEPIRYMTPAVQSERTGNEIVDFMCHST 80   Kokobera virus
Q6JJM0    1680 KGTITVLDMHPGSGKTHRVLPELIRQCIDKRLRTLVLAPTRVVLKEMERALSGKRVRFHSPAVGDQQTGNAIVDVMCHAT 1759 Omsk hemorrhagic...
A0EKU3    1669 KGEITEVNMYPGSGKTHRVLPKLVETCIQRRMRALVLAPTRVVLKEMERALGGKKVRFHSPAVTNGDVNGAIVDVMCHAT 1748 Kadam virus
A0EKU5    1681 KGNITEVDMHPGSGKTHRVLPELVRRCIAERKRTIILAPTRVVLREMEKALRGKNVRFHSDSV-DVRGEGAIVDVMCHAT 1759 Tyuleniy virus
Q9J9C2    1651 KGKLTVIDAHPGSGKTKKILPRLVDEAVGRKLRTLVLAPTRVVVKEMEQALRGKPVSFHSSAA-SKKVPGALVDVMCHAT 1729 Apoi virus
Q71SM6     126 KGKITVIDAHPGSGKTHKILPSLVRRASERRMRTLVLAPTRVVIKEMENALRGMDVSFHSSAV-SSKTPGSLIDVMCHAT 204  Montana myotis l...
Q89277    1674 KGKTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHAT 1753 Yellow fever vir...
Q71SM7     127 KGTFTMLDYHPGAGKTRKHLPNILRECERRRLKTLVLAPTRVVLSEMKEALHGVQARYHTQAFSSVVTGRELIDVMCHAT 206  Saboya virus
YP_950478 1669 KGMLTVLDFHPGAGKTRVYLPQILKECERLRLKTLVLAPTRVVLSEMKEAMPKMSIKFHTQAFSNTATGKEIIDAMCHAT 1748 Sepik virus
Q6A4R3     929 DSTRKFVTWHPGKGKTRKVIVSETKANFDSGLRTIILTPTRVVMAEVIDALAAVGINSDRNLM---YCKRNLVTVACHAT 1005 Asian tiger mosq...
2V6J_A      81 FTMKLLQ-GVRVPNYNLYIMDEAHFLDPASVAARGYIETRVSMGDAGAIFMTATPPGTTEAFPPSNS 146  Kokobera virus
Q6JJM0    1760 YVNRRLL-PQGRQNWEVAIMDEAHWTDPHSIAARGHLYSMAKENKCALVLMTATPPGKSEPFPESNG 1825 Omsk hemorrhagic fever virus
A0EKU3    1749 YVQRKLL-PTWRTNWEVAIMDEGHWTDPNSIAARGHLSSLAKENRCAFVLMTATPPGTTDPFPESRG 1814 Kadam virus
A0EKU5    1760 YTHRRLI-PVAQPNYEVAIMDEGHWTDPSSVAARGHLASLANENKCAFVLMTATPPGSVEPFPESNE 1825 Tyuleniy virus
Q9J9C2    1730 YVQRRMM-PIPQKNYELVIMDEAHWTDPSSIAARGFLDSQRKENHLSLVLMTATPPGTDDPWPQSNA 1795 Apoi virus
Q71SM6     205 FVNRKLI-HMPQKNYELIIMDEAHWTDPSSIAARGFITTMSENKKCAVVLMTATPPGVQDPWANSNE 270  Montana myotis leukoencephali...
Q89277    1754 LTYRMLE-PTRIVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPPGTSDEFPHSNG 1819 Yellow fever virus strain Fre...
Q71SM7     207 LVHRMLE-GVRSGNWEVIIMDEAHFLDPTSIAARGWAHHKSKTRESAVIFMTATPPGSSNEFPESNA 272  Saboya virus
YP_950478 1749 LTHRMLE-PTRVTNWEVVIMDEAHFMDPASIAARGWAAHRSRARECATIFMSATPPGTSNEFPESNG 1814 Sepik virus
Q6A4R3    1006 FTKFVLShGVKKIGVTLIIMDECHFMDPMSIAARGIMEHLHEKG-TKLMYLSATPPGHT-PDGGSNF 1070 Asian tiger mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap