Conserved Protein Domain Family
DDE_Tnp_ISAZ013

?
pfam07592: DDE_Tnp_ISAZ013 
Rhodopirellula transposase DDE domain
These transposases are found in the planctomycete Rhodopirellula baltica, the cyanobacterium Nostoc, and the Gram-positive bacterium Streptomyces.
Statistics
?
PSSM-Id: 400121
View PSSM: pfam07592
Aligned: 25 rows
Threshold Bit Score: 377.756
Threshold Setting Gi: 428021369
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBG67353          84 ALLALVEPDERGDPM-SP-LRWTTKSLRILADELTGQGHP----VSAMTVGRLLKDNGFSLQAQAKTLEGEQH-PNRDAQ 156 Streptomyce...
jgi:Sinac_2449   141 DLEHLINPVSKGDLA-SP-LRWTCASVRTLSAELIRMGHA----TSHRMVAELLHSSGYSLQSKRKRVEGQGL-GSRDAQ 213 Singulispha...
WP_013873074      81 ALDALVEPESRGDPM-CP-LRWTTKSTRKLSEELARQGFQ----ASHTVLRHLLPEMGYSVQAPAKTVEGASH-PDRDDQ 153 Candidatus ...
EFG07652          94 aLLALVEPDVRGDPM-SP-LRWTTKSTRHLAAELTRQGHR----ISADTVADVLREEGFSLQGNAKVIEGKQH-PDRDGQ 166 Streptomyce...
CCH30626          97 ALEALIEPRELGDPV-SP-LRWTTASLRDLARELTAAGHP----VSAPVAGRLLHRMGFSLQGMAKIRAGSQV-PDRDAQ 169 Saccharothr...
jgi:Cha6605_6235  72 iliEIAEAHGQQDPSfKTtIAYTRLTASQAICELKQRGYEenrlPAPSTMTVILNRMGYRLRPVMKAKPQKKI-PATNAI 150 Chamaesipho...
Q7TTD6             3 ELRAVIQDNTAGSPT-VPgLKWTHLSVAEIVRELFQRGIK----VANEVVSRLLGEMGFKTRQQVKSKTKAPS-RDRDEQ 76  Pirellula sp.
EIM62320          81 afLEVIKNHTAGSPM-DEtIKWTNLSRPAIAEKLKEHNFP----VSVTVVDQLLEKHHFHSRQAFKSEAGKKNiPQRDEQ 155 Desulfobact...
jgi:Osc7112_1054  93 aflEVLKFQTAGDPM-NElIKWTNLTHKEIALGLKKAGFI----VSLPIVSQLLKKHGYVKRKAQKKQTIGIN-KNRNAQ 166 Oscillatori...
jgi:Osc7112_2341  93 rfLEVLKNHTAGDPM-SEkIKWTNLTQQQIVEGLKAQEII----VSTTVVQKLLKKHGYVKRQAQKKQTTGVT-KNRNEQ 166 Oscillatori...
CBG67353         157 FRYINEQVKRHRADDEPVISVDTKKKEMLGQLPNPGRqwrpkgDPVRVDDHSFFSGPTGEaAIPYGIYD--------PSA 228 Streptomyce...
jgi:Sinac_2449   214 FEFINLKVNEALRTGQPVIMVEAMTRELADQPKARGK------SAAADDDHGPVQVSHPA-ISASGSCDpdaacehaIAH 286 Singulispha...
WP_013873074     154 FRYIAGQVAEFQTAGQPVISVDTKKKELVGNYDNGGRewqptgRLVHVKDHDFPDPDIPK-AVPYGIYD--------LTQ 224 Candidatus ...
EFG07652         167 FRYINDQAKDHQAVGDPVISVDTKKKEVVGPLKNGGRewrpagDPERVSTHDFPDRELGK-AVPYGIYD--------LAA 237 Streptomyce...
CCH30626         170 FRHIDAAVESFLAAGLPVVSVDAKKKEPIGDFARAGRtwrphgRPITAPDHDFTYSDTPI-AIPYGVYD--------IGR 240 Saccharothr...
jgi:Cha6605_6235 151 FLNIKQ-KDQHQTPGVKRLSLDCKATVTIGDYSKGGKt----rGNNQALDHDLGSKEK---YIPFGIVD--------EDS 214 Chamaesipho...
Q7TTD6            77 FEKIEKSIEDYKNTGDPVFSIDSKRKESLGEVHRSGDvi--anQAAEVLDHDLPAYRDGE-VTPHGIYD--------VQE 145 Pirellula sp.
EIM62320         156 FKNIQRLNQKYHEEGHPVLSMDVKKKELIGNFFRSGKly--tqEPIRVNDHDFVSNSDGK-VAPHGLYD--------IYR 224 Desulfobact...
jgi:Osc7112_1054 167 FENIAILDTQYREAGNPIISFDTKKKEVLGNLYRPGTly--ttEPLITLDHDFWSLGCGK-VIPHGIYD--------CQK 235 Oscillatori...
jgi:Osc7112_2341 167 FENLARITAEYELQGNPIVSMDTKKKEFIGNLYRAGSly--ttEAITTFDHDFWSLAEGK-VVPHGIYD--------LQH 235 Oscillatori...
CBG67353         229 DTGWVNVGVDHDTSVFAVASIRRWWQARGRHDYPQASQLLITADAGGSNGYRYRLWKAELAEFAAETGLAVTVCHFPPGT 308 Streptomyce...
jgi:Sinac_2449   287 GKGRSGVLVDRDMAEFAVEVIQHWWHSMGRAIFPHPQRLLVIADIDGGDESTSRLWRTGLQKLSDETNLVISIHHFPPAT 366 Singulispha...
WP_013873074     225 DSGWVTVGTSADTAEFALATISRWWDKVGSQAYPHARQLLITADAGGSNSCRSRLRKTELAAFAARTGIEVTVCHFPPGT 304 Candidatus ...
EFG07652         238 NTGWVSVGTDHDTAAFAVESIRRWWKARGTQDYPQARRLLITADAGGSNGYRTRAWKAELASLALETGLHITVCHFPPGT 317 Streptomyce...
CCH30626         241 DSGWVNVGTDRNTAAFAVESLRRWWNDQGRLDYPAATGLLVTADADGANSADSTLFKTDIATFCDESGLTITVKHFPPGT 320 Saccharothr...
jgi:Cha6605_6235 215 GQLYLSFGSSYKTSDFIVDTIEQWWSSLSTLERCATNLIQLKVDNGSESSGIRTQFLYRMVEFSQRIGTPVQLLYYPPYH 294 Chamaesipho...
Q7TTD6           146 NTGHVTVTTGSDTGEFAVASFQRYWEEVGSVQHASAKRILLLCDCGGSNSYRSNTLKHHLQELSNELGLPIQVAHYPVHC 225 Pirellula sp.
EIM62320         225 NIGYVTLTTSHDTSEFACECIRRWWLTYGKYDYSGSNSLLLLCDCGGSNNARYYIFKEDLQKLSDELKIKIRIAHFPPYT 304 Desulfobact...
jgi:Osc7112_1054 236 NRGYVTLGNSKDTSEFACESIKNWWNNYGKAAYPNANSILAKCDGGGSNNANHYIFKQDLQKLVDEIGIEIRIAHYPPYT 315 Oscillatori...
jgi:Osc7112_2341 236 NRGYLNLGISKDTSEFACESIKLWWVNYGKFIYPQADSILIKCDGGGSNNSNHHIFKSDLQKLVDELGIEIRIAHYPPYT 315 Oscillatori...
CBG67353         309 SKWNKIEHRLFSHITMNWRGRPLTSHEVVVNAIAATKTRSGLRVEAELDTGRYP---LGIEVSKAQLKSLP--IEYHDTH 383 Streptomyce...
jgi:Sinac_2449   367 TRWSHIEHRLVATISPHLRNKPGVSHDVVVNLIVAAPAGTDSGENRERANEGLP---RGAELSYTEIENLL--LTADGLH 441 Singulispha...
WP_013873074     305 SKWNKIEHRLFSHISMNWRGRPLESHEVVVNLIGSTTTRTGLQVHAELDEKTDE---KGIKISDDEMAIID--RTEHLFH 379 Candidatus ...
EFG07652         318 SKWNRIEHRLFSHITMNWRGRPLTSHEVIVQSIAATTTRTGLKVHAELDSATYA---TGVRVVDRQLDALP--LARHEWH 392 Streptomyce...
CCH30626         321 SKWNKVEHRLFSRITHSLRGQPSTSYEVLLRSI--STTRTGLTVKATLDHNDYP---TGRTLTKAERQAVAhrVEREEFH 395 Saccharothr...
jgi:Cha6605_6235 295 SKYNPIE-RCWGILEQHWNGAKLIDVETMLAW-AQSMTWKGINPIVNLSQSIYA---KGISLSKQQMEIVEqsLKRNPEL 369 Chamaesipho...
Q7TTD6           226 SKYNPIERREFSHVERAFSGRIFSTASDVAEAAESTSTQTGLNVTTAELPEFQPvrkSGKRVPKPPN------VEYDKDL 299 Pirellula sp.
EIM62320         305 SKYNPIEHRLFPHITRACKGVIFKSIEIVNDFVAKTKTSTGLKVFTSILDKNFK---TGRKVADDFKKNMR--IQFDEYL 379 Desulfobact...
jgi:Osc7112_1054 316 SKYNPIEHRLFPHITRACQGVIFTSLNLVKNLMEKTHTNQGLCVVVNVVDKIYE---IGRKVSDDFKKNLK--IVFDEYL 390 Oscillatori...
jgi:Osc7112_2341 316 SKYNPIEHRLFPHVTRACQGVIFTSLELVKKLMAKTHTKTGLSVVVNVIDKIYE---TGRKVAKGFKETMK--IIFDEYL 390 Oscillatori...
CBG67353         384 GTWNYTVRP 392 Streptomyces scabiei 87.22
jgi:Sinac_2449   442 GGWNDSIRP 450 Singulisphaera acidiphila DSM 18658
WP_013873074     380 GEWNYTIRP 388 Candidatus Frankia datiscae
EFG07652         393 GDWNYTLRP 401 Streptomyces clavuligerus ATCC 27064
CCH30626         396 GEWNYAIAP 404 Saccharothrix espanaensis DSM 44229
jgi:Cha6605_6235 370 PKWDILICp 378 Chamaesiphon minutus PCC 6605
Q7TTD6           300 PDYNYTFNP 308 Pirellula sp.
EIM62320         380 PQWNYVAlp 388 Desulfobacter postgatei 2ac9
jgi:Osc7112_1054 391 PKWNYRAVP 399 Oscillatoria nigro-viridis PCC 7112
jgi:Osc7112_2341 391 PKWNYRAVP 399 Oscillatoria nigro-viridis PCC 7112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap