4XMN


Conserved Protein Domain Family
Nucleopor_Nup85

?
pfam07575: Nucleopor_Nup85 
Click on image for an interactive view with Cn3D
Nup85 Nucleoporin
A family of nucleoporins conserved from yeast to human. THe nuclear pore complex is a large assembly composed of two essential complexes: the heptameric Nup84 complex and the heteromeric Nic96-containing complex. The Nup84 complex is composed of one copy each of Nup84, Nup85, Nup120, Nup133, Nup145C, Sec13, and Seh1. The structure of a complex of Nup85 and Seh1 was solved. The N-terminus of Nup85 is inserted and forms a three-stranded blade that completes the Seh1 6-bladed beta-propeller in trans. Following its N-terminal insertion blade, Nup85 forms a compact cuboid structure composed of 20 helices, with two distinct modules, referred to as crown and trunk.
Statistics
?
PSSM-Id: 400113
View PSSM: pfam07575
Aligned: 59 rows
Threshold Bit Score: 383.923
Threshold Setting Gi: 562970360
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XMN_D        30 KLYPVRIpRLDTSKEFSAYVSGLFEIYRDLGDDRVFNv------pTIGVVNSNFAKEHNATVNLAXEAILNELEVFIGRV 103 Saccharomyces c...
XP_002006268  60 LIYMAQEtTLYTEPLLRSLLAETNATFATLQVLGQGP--------KGDAKKTAEYIKISRTYRSIIRCCLEKLEHAKQSP 131 Drosophila moja...
Q16KI2        56 NVYHLTTnFILDEPILRSLVTECSNVFLNLQLVR-----------NSSPAAAIDFLKISRSYRSAIRACLEKLQDLIANT 124 yellow fever mo...
ETN63003      66 DIQHFDVdLVLEEPTIRSMVSECGRLFYQLQQLRYGL--------TGRQTQTIDFVDQSLRYRTIVRQALEKLNRLLNEL 137 Anopheles darlingi
KRH04885      60 EVKLAGEdSEIPDAHWRRIAYGSVAPFALLQSRRSSLsal----lkTPSPYRSDWWEHVLQYSKEIGSLLGGPK-LPASP 134 soybean
CBI20847      73 QVKLGVAdGEVDDAQWRRIAYGSVSPFALLQSRRNSVlals-kmsMSSSPYHPDWWEYVMEYSKDISSLLDNAK-SLPNS 150 wine grape
EEF45847      81 vklggngdGELNDAYWRRIAYASVSPYALLKSRRNCAsnls-klqLSPSPYHLEWWEYVMEYSKDISSFLVNPKSSTAGP 159 castor bean
Q8RXH2        73 NVRLSGEdGEISDPQWRRIAYGSVSPFALLQSRRNSIssls-kmdMSSSLYQTAWWEYVMEYSRDIKSLLSNTI-SLPAP 150 thale cress
ERN15082      76 ELRMGVEdGEIDEVRKRRIAYGSAPAFALLQSRRNLVmasn----sfgSSLHSDWWQHVLEYSRHIRDLLGNLK-SSPVS 150 Amborella trich...
XP_004969928  84 gnggaeVeEEIDEAEMRRIEYGSVPAFALLQSRKNALadaaamsrMSSVPDYAEWWQYVLEYSKTIGNLLGNPD-SPPAF 162 foxtail millet
4XMN_D       104 -------------------KDQDGRvnrfyeLEESLTVLNCLRTXYFILDgqdvEenRSEFIESLLNWINRSDGE--PDE 162 Saccharomyces c...
XP_002006268 132 eiqene-------aikqrhADAILT------FYAIECLWHLFEILYMQQq------hNQLIVTQLLEWTRF---HypNTE 189 Drosophila moja...
Q16KI2       125 dlrd-----------veqyRNYVTI------FYSVESIWHLVEILIIDAS----S--VNAVVPNLLEWVRF---HfpTAE 178 yellow fever mo...
ETN63003     138 sqteaqedhapsyhtlksyQDLVAL------FYSIECTWHLLEFLLLDSN----N--STTIVAPLLEWIRH---HypTPA 202 Anopheles darlingi
KRH04885     135 iied-----------pnviAKRGEE------PTSLKAAWELIEIFYVDKQ----S--QAWLPERLVDWLADYASLftSTH 191 soybean
CBI20847     151 midd-----------pktvLKKVEE------PTCLKAAWGLLEIFYADKE----S--QAWLPERIVDWLADYDVLfsGTQ 207 wine grape
EEF45847     160 vied-----------pkefLEKRER------PTCLRAAWDLMEIFYADKL----A--QSWIPERMVDWLSDYDILlsSTQ 216 castor bean
Q8RXH2       151 lied-----------prsvIKNAEE------PTSLKAAWELMELFYADKT----C--LSWLPERLVDWLSEYDILlsSSH 207 thale cress
ERN15082     151 vied-----------pkalLKSSEK------PTSSKAAWELMEFFYVDKL----S--LSWLPERLVDWLADYDSLlsGTD 207 Amborella trich...
XP_004969928 163 mied-----------pktiLKVREK------PTSLRAAWELLEIFYVDKQ----L--QSWLPERLVDWLADFDSLlsATE 219 foxtail millet
4XMN_D       163 EYIEQVFSVkd--stAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSD-TCAVSFDAVSDSIELLKQYPKD 239 Saccharomyces c...
XP_002006268 190 DAATDLLL-------MAEEASECESYWDTLKALIMLGQLDVTRAILSQHRKFNQTAF----------QTADLVLKSMPVY 252 Drosophila moja...
Q16KI2       179 RLATELLQ-------QGREVDSSDDYWPVLKGLIIQGQLSVARALLKLHTNSESVCF----------EVAEQILQTMPVY 241 yellow fever mo...
ETN63003     203 LDAAELLS-------SGRQIDLPENYWSVVKALILQGQTTIARALLRLHVAADTQSF----------STVDQLLHSFPIY 265 Anopheles darlingi
KRH04885     192 ETIHGKLVDfqkelvNIQVIEEDPRYWDLLSSALSVGWLDIVVKMLRLHGSYQLDQLsNRELENGLVEAVAVLISKMPRM 271 soybean
CBI20847     208 ATVHSKLVEfqkeivRLQVIEDDPRYWEVITSALAVGWLEIVVKLLRLHGSYQLDQLsNRETENGLVEAVAILISKMPRM 287 wine grape
EEF45847     217 ETVYMKLVEfqeelvTLQVIEDNPKFWEVISSALAVGWLEIAVKVLRLHGSYQLDQLgSRETENGLVEAVAVLVSKMPRI 296 castor bean
Q8RXH2       208 PTIYSKLQDfqkelvGLQAIEDDPRYWEVMASALSVGWLEIVVKLLHLHGSYQLDQLgHRETENGLVEAVAVLISKMPRM 287 thale cress
ERN15082     208 MTVHSKLASlqkklvELQFIEDSKEYWEAIASALAVGWLDIVVKLLRLHGSYQLDQIdNREIENGLVEAIAVLVSTMPRM 287 Amborella trich...
XP_004969928 220 STVYSKLSNfqkkliNLQIVEDDPDYWNGLSAALSVGWLDIVVNMLRFHGSYQLDQMdNRETENGLVEAVAVLVSTMPRL 299 foxtail millet
4XMN_D       240 ------------------SSSTFREWKNLVLKLSQAFGSsaTDISGELRDYIEDFLLVIGGNQR---KILQYS-RTWYES 297 Saccharomyces c...
XP_002006268 253 qdgy----------amqkFCSQWEYWHVDLERKLAAHVF-------ATEPELELLMQLVSGSNEhwdAALMKS-HDWYEF 314 Drosophila moja...
Q16KI2       242 svygg--------lsiqkFKSQWQYWSANARSKVDAGIL-------AVEPELEEIIKLVIGDRQtwtEQCRYA-SCWYEY 305 yellow fever mo...
ETN63003     266 tvygg--------lsvhkFRSQWNCWTSNVRTLLATGHF-------ADEPNLEELLRLVTGDRQawkQQLSSSgGAWYEH 330 Anopheles darlingi
KRH04885     272 rpesvgklg-ecykskpdFIKAWEKWRSQI-TKLDCSRFwiQCDNQQTREGLRNLLQIMLGNTE---SLCMAT-CYWIEL 345 soybean
CBI20847     288 rpeleagrlgecfktkpdFIKAWEKWRAQI-TKLDCSSFwvQCDHRQTREGLRNMLQLMLGNTN---NLCTST-CHWIEL 362 wine grape
EEF45847     297 rpgltagklgecfkakpdFMKAWERWRAQV-TKLESSAFwvQCDHRRTREGLKNMLQIMLGNTN---ILSTMT-CNWVEM 371 castor bean
Q8RXH2       288 rpqledgkfgecsaakpdFMKTRERWQSQI-TKLECSAFwvQCAHHQTREGLRNMLKIMIGNAD---CLRAAT-CNWMEL 362 thale cress
ERN15082     288 rpelragglgqcfdtkpdFVKAWEKWRGQV-AKLDCSAFwvKCDHRQTMDGLKNLLQIMLGNLD---DLCAAT-YQWMEL 362 Amborella trich...
XP_004969928 300 rpnlptgklgqccktrpdFVKAWEKWRGQV-TKLECSAFwiQCGHQKTRDGLKNLLHIMMGNIK---ELTAST-SHWLEL 374 foxtail millet
4XMN_D       298 FCGFLLYYIPSLelSA-EyLQXSLEAN-------------VVDITNDWEQPCVDIISGKIHSILPVXESL--DSCTAAFT 361 Saccharomyces c...
XP_002006268 315 LPGYLLFTRPAC--KPfE-LRIAASNWinrw-----sglrPNWEMTQLSRMVMQLMEHDIKLFIYESQKLgdSHWFATHL 386 Drosophila moja...
Q16KI2       306 FPGYLFYTESTC--KYyE-LGTFANNWlsqwi----stggANPSYKYLDKIILSVMENNLPQVLHNIQNIcdNKWFVTHL 378 yellow fever mo...
ETN63003     331 FPGFLLYTDSTC--KYyE-LPEHVNEWmelfreahslstgTSNN-TLLDNLVLAVMENDLIKLLHQIQQLpdNGWFAVHL 406 Anopheles darlingi
KRH04885     346 YISHFLYIRPFT--MGiEsMYNLAQKCiq---------lkPRSSTHRLSVLMIGILEENTEVVLAECSREfgP-WLVAHA 413 soybean
CBI20847     363 YISHFLYVRPFT--VGlEsMHALAQKCiq---------lkPISSSHRLMGLIVGILGENTEVVLAECSRAfgP-WMVAHA 430 wine grape
EEF45847     372 YISHILYIRPFT--VGlEsMYSLAQKCiq---------lkPTSSPHKLMQLILGILGENTEVILAECSRGfgP-WMVTHA 439 castor bean
Q8RXH2       363 FVSHLLYLRPFT--KGlDgMHSLAQKCvq---------skPVNTSHKLLRLLIGILGENTEVVLAECSKEfgS-WMVAHA 430 thale cress
ERN15082     363 LTSHFLFIRPFT--MGlEaMHSLAQKCil---------lkPTSDGNRLMDLLLGILGDNTEVVLAECSRTfgP-WMVVHA 430 Amborella trich...
XP_004969928 375 FASHFLYIRPFT--VGfEgMHHLAQKCiq---------lkPSSSTTGLTGLVIGVLSENPEVVLAECTKHfgP-WLVTHA 442 foxtail millet
4XMN_D       362 AXICEAKGLI--------ENIFEGEknsddysnednexledLFSYRngxasYXLNSFAFELCSlgDKELWPVAIGLIALS 433 Saccharomyces c...
XP_002006268 387 IDLIYHTGHLksyfdqqhIDLPS--------------------LRF-----SMIFDYGSYLMT--SHNLWQLGIDYLDCC 439 Drosophila moja...
Q16KI2       379 VDLLYHCGQLtlstggnvEEQDTEKm-----------------FRE-----SLLYDFGCLLMSr-NSSLWEAGLDYLEFS 435 yellow fever mo...
ETN63003     407 VDLLYHAGQLdlgrsrlpDEDATGEgasvedg----lvdngklMRE-----SLLYEFGTILMT--HRTLWQLGMDYLEFS 475 Anopheles darlingi
KRH04885     414 IELLT-----------------AGSeqaeillheerynlggISIVE-----LHRLVYAQILSS--HALTWQIAPIYLTSC 469 soybean
CBI20847     431 IELLT-----------------AGSdqaeiilqegrdnlggISIEE-----LHRLIYAQVLSS--HALTWQIAPIYLTSC 486 wine grape
EEF45847     440 IELLT-----------------AGSvqaemllneerdnlggISIGE-----LHQLVYAQVLSS--HILTWQIAPIYLISC 495 castor bean
Q8RXH2       431 MELLT-----------------AGSeegevlvheeqrklggINMEE-----LHRLVYAQVLSS--HALTWQIAPIYLASC 486 thale cress
ERN15082     431 IELLT-----------------AKShqaevvlheqrynlggISIEE-----LHRLVYAQVLSS--HALTWQLAPIYLAAC 486 Amborella trich...
XP_004969928 443 MELLT-----------------ADNdyadtmlheerpnlggISIEE-----LHRLVYAQVLCS--HSLTWQIAPTYLSSC 498 foxtail millet
4XMN_D       434 AtgtrSAKKXVIAELLPHYPFVTNDDIEWXLSICVEWRLPEIAKEIYTTLGNQXLSAHNIIESIANFSRAGKYELVKSYS 513 Saccharomyces c...
XP_002006268 440 K----QEGLAAIELLLPRIPLKSERQAFKIIAMAKERGLVNVEQSICKVLSKRAYSDQRYGNALEWAMRSKDVLLVTAIA 515 Drosophila moja...
Q16KI2       436 S----TEGLGAREALLSRIPIKNEKQAMKLINVAKKNGFTSVESEICKVLVKRNLTNKQYGNALEWAIRSRDSFYVTAVA 511 yellow fever mo...
ETN63003     476 N----TLGLGAREVLLGRIPLRNEREALKVFAVARKNGYRGIATEVCKVQSRRYLALKRYGSALDWANKSGDGGCISEVA 551 Anopheles darlingi
KRH04885     470 M----KQGMGLLENLLYRQSAQHNDVLLKNIEICRLYELDHISSNIMKIAGVHHWKHGHKGAGVFWLQQAQDASCLDKIA 545 soybean
CBI20847     487 M----KQGMGLLEVLLYKQPVQDNQMLLKTTEICRLYDLESISSSIMKIAGVYHWKHGRKGSGVFWLQQARDEFRLNRIA 562 wine grape
EEF45847     496 I----KQGMGLLESLLYRQPVQYNELLIKNLEICRLNELDSVSRDIMKIAGVYHWKHGKKGSGVYWLRQARDEVSLNRIA 571 castor bean
Q8RXH2       487 E----KQGLGLLELLFYRQPVQENQMLIKSLEICRLYELSNVSAKLMKISGVHHWKHGRKGSGIFWLQQARDENCLSVIA 562 thale cress
ERN15082     487 P----KQGLGLLELLLYKQPMRHNRQILKNIEICRLYELGQIESSIMKIAGMHHWKHGRKGAGIYWLQRAGDEARLNEIA 562 Amborella trich...
XP_004969928 499 L----NQGLGLLEILLLKQPIQDNRLVLKTLEICRLYELDNISTNIMKVAGIYHWKHGRKGVGVYWFQQAHDKVRLDRIA 574 foxtail millet
4XMN_D       514 WLLF----EASCXEGQKL----DDPVLNAIvsknspaeddviipqdildcvvtnSXRQTLAPYAVLSQFYEL-------- 577 Saccharomyces c...
XP_002006268 516 DFIL----KHYSNTGVMLcpdvITSIGARM------------------------FVSPRLVFLSKYFEFYEL-------- 559 Drosophila moja...
Q16KI2       512 NIFL----EHYCNHGEILcedvIANIGAKM------------------------FCSPRLIFLVKYYDFRQF-------- 555 yellow fever mo...
ETN63003     552 NIFL----EYYCNHGELLceetIANLDSEM------------------------FLSSRLMFLKKYHDFRKY-------- 595 Anopheles darlingi
KRH04885     546 QQLFdsvgKSISDESFKQwegmIELLGSES------------------------KPAGGLEFLHKYRDFKKSlqkv---- 597 soybean
CBI20847     563 QQLFdfvgRSISDESFKQweglIELLGSES------------------------KIAGGLDFLHKYRDFKKSlqqv---- 614 wine grape
EEF45847     572 QQLFdsvgKSISDESFKQweglIGLLGSES------------------------KPAGGLEFLHKYRDFKKSlkqv---- 623 castor bean
Q8RXH2       563 QQLFdsvgKSLSDESLKQweglVELLGSES------------------------QISGGLDFLHKYRDFKRSlkvv---- 614 thale cress
ERN15082     563 QQLFglvgKSFSDESFRQwerlIELLGVEG------------------------ENLGGLEFLHKYRDFKKSlqmipddv 618 Amborella trich...
XP_004969928 575 QQLFehigKSVADDSFKQweglLELLGSDI------------------------GSAGGLEFLHRYRDFKRSlhqa---- 626 foxtail millet
4XMN_D       578 -------RDREDWGQALRLLLLLIEFPYLPKHYLVLLVAKFLYPIFLLDDkkLXDEDSVATVIEVIET 638 Saccharomyces cerevisiae S288C
XP_002006268 560 -------YRQRDFLSGAELLINLLASKITPDYFWPSLLIDALPLLE-SEDp-KIFSKETIAILQHLEM 618 Drosophila mojavensis
Q16KI2       556 -------FLERSFAQAAELLVNLLDSKITPSYFWPSLLADTIPLLE-FKEp-VIPTKETYTILHHLEW 614 yellow fever mosquito
ETN63003     596 -------YRDQAYASAAELLVSLMDSKIMPSYFWPCLMSDAIPLLE-FKEp-IIPSKETLIILEHLQL 654 Anopheles darlingi
KRH04885     598 ----ssgKSTDAARQAVGSLILLMKNPSTPQRFWLPLLYDSLKLLNWQDCp-LLSVSETNLLLNKLHE 660 soybean
CBI20847     615 ----qvgKTTDAAQQAVESLISLMRNPSTPQRFWLPLLHDSLKLLSWQERp-LLNANQTNLLLNKLQE 677 wine grape
EEF45847     624 ----ydgKTTDAARVAAESLLSLMKSPSTPQRFWLPLLNDSLKLLSWEERp-LLNVSQTNLLLNKLQE 686 castor bean
Q8RXH2       615 ----hdgKTIDAAHEAVERLVSLMKSPSTPQRFWLPLLHDSLKLLNWPERs-LLNVTQTNLMLNKLQE 677 thale cress
ERN15082     619 siepsneKAVNAAVQAVDALILLMKSPSTPQRFWLPLLQDSMKLLNWRHRp-LLNVSQTNLLLNKLQE 685 Amborella trichopoda
XP_004969928 627 ----ldgRSGEAARQTVDFLIQLMRNPSTPQRFWLPLLHDSMELLNCKPSp-LMNVAETNLLLNKLQE 689 foxtail millet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap