Conserved Protein Domain Family
DRIM

?
pfam07539: DRIM 
Down-regulated in metastasis
These eukaryotic proteins include DRIM (Down-Regulated In Metastasis), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells. It is believed to be involved in processing of non-coding RNA.
Statistics
?
PSSM-Id: 400086
View PSSM: pfam07539
Aligned: 142 rows
Threshold Bit Score: 338.76
Threshold Setting Gi: 163772733
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDQ86381      1044 VLASITQFLQLFAVLKRGDALPMSAELQDAFLQVLQRPEEDMQEHALTALYIFKSfRvNVKPYHQQLTLVIRSHraKLRE 1123 Monosiga bre...
XP_012551247   887 IFKTLINIMQVLAQFKNPRALHKEPVFWELYMEFLKHKNPGLQKFALDCVLNYKN-K-SITVYKSNLYNLIDEK--KFKD 962  domestic sil...
OWR44952       886 IFKTLINIMQVLSQFKNPRALHKEPVFAEVYLEFLKNKNPGLQKYALDCILNYKN-K-SVVPYKANLHNLIDEN--KFKD 961  Danaus plexi...
XP_969008      844 NLQVLLTCLPVFTKIRSPKSIYREPELAKLYFDFLQHKNSQVQKLALDCIMTYKH-K-FLTPYKDHLYNLVDDK--NFKN 919  red flour be...
XP_001605633   869 rvKLLLAMLQVFGKFTNVRSLYREPEILRIYLDLLSSKNSEIQKAALHCLYTYRH-K-YLTPYKEQLDNIVDEK--NLKN 944  jewel wasp
EFN80082       250 kTKLLIAQMEIFGRVLNPKVLYREAEMHQIYLDLLCSKNTDIQKAALNCLFIYKY-N-YLLPYKESLYGLISEK--NLKN 325  Jerdon's jum...
XP_011256579   864 kveYLLAQLEVFEKVLNPRMLHREAEMYQIYLDLLSSKNANIQKTTLNCLFAYKH-E-YLLPYKESLYSLISEK--NLKN 939  Florida carp...
10_pfamImport    3 ITKTLLVHMRVLGKFRSPKNIYREADLHKIYIDFLSHKAAEVQKAALDCLMTYKH-K-FLFPYREHLYGLIDDK--TFKN 78  
XP_001952794   855 LTKLLLSHLKLMSTIRNPKGIYKESEVFDVYLSLLSNKNAEIQKAAFDCLLTYKQ-K-HVTPYKENLYKLINEK--SFKA 930  pea aphid
XP_002063362   845 ILQTLQLKLACFTIQPNPKALYRQTELKEFYLELLAGPNPQLQQLALDCLVKYKDpT-ALVQHKSTLSDLIDEL--KFKS 921  Drosophila w...
EDQ86381      1124 ILQKFNIESq---DGVLKAEHRDACIATLHRILLAKMFARRGRSKQYNpr--dQRRLVLRYLQGSTQEELLDFVRLVTRP 1198 Monosiga bre...
XP_012551247   963 ELTQFKITEd---SQLIHSDDREHVIPIILRILYGKMTCKLA--GDKKsggqaRRSLVMRYLAGCSENELRMFIEMAFSY 1037 domestic sil...
OWR44952       962 ELTQFKITDg---SPAIQAEHREHVIPLILRILYGKMTSKLG--ADKKgggqaRRSLIMRYISGCNETELKIFIEMAFSY 1036 Danaus plexi...
XP_969008      920 ELAAFQIDKe---SGTIQEEHRDDLVPLIIRIVFSKMSTKTGLRTGGKssgqlRRNLVLRFLAGCQDKEMLAFVKMAFQY 996  red flour be...
XP_001605633   945 ELARFQISVgegiEAVVQEEHREGLIPVLMRILHSKMSQRVGMRTGGKtgglvRRKTILRFLAGVKEEEMMVFVRMAFKP 1024 jewel wasp
EFN80082       326 ELARFKLDKe---SNMIQEEHRENLIPIIMRIIYAKMIMKTGMRTGGKaggfaRRKIILRFLAGTQENEMITFVKMAFRS 402  Jerdon's jum...
XP_011256579   940 ELAHFKLDRe---SNVIKEAHRENLMPIILRIIYAKMIMKTGMRTGGKasgseRRKMILRFLSGTQEDEMIVFVQMAFRP 1016 Florida carp...
10_pfamImport   79 EITVFRIDTe---SEVLRPEHRSDLIPFVLRIVYSKMYTRTN--TVKGvnrqdRKASVIRFLAGCSPEELICFFKMVFAA 153 
XP_001952794   931 ELVMFRVDSe---SEAILSEHRPLLMPLIMRMIYGKLLGGGGPKSGSKcsgqnRRTAIMRFLVGCEERELIVFMQMVFRV 1007 pea aphid
XP_002063362   922 TLSTWNLS-------NLQTEERAQLLPYVLRLLYGKMLTKGS---QKQlsaqqRKTLILRFLGQLEELEILNFLQMAFGR 991  Drosophila w...
EDQ86381      1199 iednVDNVLsaeaattqNS-AVD---------------VTRAPPLKRQLGFMAFVTDLVQVLGAHL-APFLPHVMQMLLg 1261 Monosiga bre...
XP_012551247  1038 ----FKKYmamepreif-------------enihnnldLKSITGPGKLHSILNLFEVVREYFGGYMkDELLSELFKIFY- 1099 domestic sil...
OWR44952      1037 ----LKEYlimepkeiy-------------envqrnldLKSVTSPGKLHSMLNLFDVVREYFGGYMnDELLTYFLKIFY- 1098 Danaus plexi...
XP_969008      997 ----YSKFldddpqvm--------------vkglesitLESYIPPKRLQSAINLLNVILDQFGGLMgNELLTFILQIVL- 1057 red flour be...
XP_001605633  1025 ----FQNYLpilkldeaSYaAGGvdlqqmvqdifkninLENVVPPKRLSSAVNLLAVIIEQFGGKMtEKLLPHLLAILI- 1099 jewel wasp
EFN80082       403 ----Yms---------leM-NQAfslkqhakkivdtidLSNIMPPKRMQSAVNLLAIVMEQFGGKMsTKLLPHLFGILI- 467  Jerdon's jum...
XP_011256579  1017 ----FKSYis------leMeDGAfdlkryiekimdtidLSNVIPPKRMQSTVKLLAIMMEEFGGKMsTRLLPCLLRMLI- 1085 Florida carp...
10_pfamImport  154 ----FHGKv-----------eKIgnilelaertiseleLECVIPPKKMQSQIYLLNTVLIYCGGLLgRDHQNYLLRILI- 217 
XP_001952794  1008 ----LNCQvqf---secP---LVmtrhi-----vdtldLEHVLPPRRLLSSVNMCAVILKQCGALSgTDGLYYMLRVLL- 1071 pea aphid
XP_002063362   992 ----FNLYtdkpieelh-------------levikhydPSAVIAAKQLQRIVNLLELIRKEFAGKLsEKFQSYVLKLLL- 1053 Drosophila w...
EDQ86381      1262 ILQTTD-----SLlaqrdliarRHVAVLKSVRREGLRRIVLIYQTFQrRLlvDYDRD----IDRILVSPHLDSFVAEQLQ 1332 Monosiga bre...
XP_012551247  1100 AVCSTFsavlsRAdkv----hvGYVKVMKNLRTIALVTVKKLFEQLD-KYp--WSKDelyvIFETLLWPLIPKLHIEGIH 1172 domestic sil...
OWR44952      1099 AVSSNIanvlvNVekv----hvSYVKVMKNLRTLSIIILGKLFDQFE-KYp--WKRDelyvLFQTLIWPLVPRLQIEGIH 1171 Danaus plexi...
XP_969008     1058 IIggv----lkIAfgqignvhaGYLAILRTLRTGAIKLVERFFGQFE-RYq--WTNKqinaIFHIFVWPYLDKLNVEGIH 1130 red flour be...
XP_001605633  1100 CILAQVagillKSsev----hsGYLTSLRNVRNNCINVLARFFAHFE-NYd--WTSSeinaLFQVAVFPWLNKLPVEGIH 1172 jewel wasp
EFN80082       468 CILAEAtgilrRSeev----yaGYLPIIKNVRTNCIGVLARFFVHFE-EYd--WKQHeidaVFDVAIFPWLPKLPVESIH 540  Jerdon's jum...
XP_011256579  1086 CILAEVtgilhKTdev----ypGYLPAIKNVRTSCIDILTRFFKHFE-DYn--WKRHeidaVCHVAIFPWLQKLPVEGIH 1158 Florida carp...
10_pfamImport  218 SVSGHLagifqMRerv----hpCYLRTLRDIKNTSFEALIKFYEKFE-TYe--WTLEeteaVF---------KLSLSGCA 281 
XP_001952794  1072 CVGANVkailmHRssv----haGYFSTISKVRVTTVETLTTFFQHFE-NFs--WNKSfldsVFEVFIEPSLSKMPVECLQ 1144 pea aphid
XP_002063362  1054 LVGSVAqqvidGGegg---klmVAY---RNVKHAGLQTLVNYFQHLV-DMheLWQEPeiqaICEVYVWPNLSRLSQDSIH 1126 Drosophila w...
EDQ86381      1333 RPSPLMELFTLWSELPTLVDLFTAy-----NQAVLPTMWAVLSHPHAKPSAVAAVLTVIDNLLPTHDDLKRakrferrta 1407 Monosiga bre...
XP_012551247  1173 SPTALLKLLSVWCQNPRYYVLLVTrsk-dnsLSSLPELLKLLLAPKTSPIVVNMILDMIEKLLTLTENEEDkelspiesf 1251 domestic sil...
OWR44952      1172 SPTALLKLFNIWCQNPRYYILLITcseddsELSALPAIFKLLLAPKTSPGVVNMILDMIEKLLTLT-NEDEnevteiktf 1250 Danaus plexi...
XP_969008     1131 SPTTLLKLFVQWGSNPRYFSLLVKhedgrqDQYVLPHVIRLLLNPKSHITVVNAIEEMVEKLLTLQ--ADEedlqlvipv 1208 red flour be...
XP_001605633  1173 SPTPLLKMFAAWSHNPRYYPLFVKlde-drkMTPLDSVIRLLLGLKTHKSVLQMILDMVEKMLTLQDFEKEnpdqlmevd 1251 jewel wasp
EFN80082       541 SPTALLKLFIAWGQNPRYYPLFVKhqednkSVSPLPYIMQLISNPKTHPSVINAVLETIEKMLTLQDYRKSnedtgemqi 620  Jerdon's jum...
XP_011256579  1159 SPTALLKLFMAWGENPRYHPLFAKhreddeSITPLPYIVELLLNSKSHQSVVNAILLIIENLLTLQDYDQSnedsmqvdv 1238 Florida carp...
10_pfamImport  282 RIVEYFKLI---CKIYRYFVLLGKyleddkNLAPLRFIIELWLSPKIHGSVYNTILDLIENMFVLQ--QDDtsefkriev 356 
XP_001952794  1145 HPTPLMKLLVVWSQIPRYYCLLGYpi---nnLTPIEILIDILTSDKTHGGVKKIILEVIDRLLTFDGTYNDamdvdvpal 1221 pea aphid
XP_002063362  1127 NPTPLLKLLLLWGAEVNYQKWLKRqpe-kgaDPIIQHLVALLLNEKAKPVVKRSLLQLIEQILEATALDEYke------- 1198 Drosophila w...
EDQ86381      1408 daqngvtksdandadsdgeaadvveqyragvkveeeefmrelAAKRAVMTDHVSSLLAHMAAYIfnkyadsapadtmdet 1487 Monosiga bre...
XP_012551247  1252 niip--------------------------ndeivstdmsniNYGSKILIPHIPSILEVMKRRMana------------- 1292 domestic sil...
OWR44952      1251 ss-----------------------------lpisgnvkndiNFGSKILLPHLPSILEVMKRRIans------------- 1288 Danaus plexi...
XP_969008     1209 dnllpv----------------------pqhildriklddklNYGSCILLPFVSSILEKIQRRLdg-------------- 1252 red flour be...
XP_001605633  1252 efkpksl-------------------mptvtnklqvekndsiNYGSAILLPHVTDILVYIERKLkrq------------- 1299 jewel wasp
EFN80082       621 dspflplip----------------iltnlieveekifstgiNYGSAILLPHIPHILEFIKSRLkkr------------- 671  Jerdon's jum...
XP_011256579  1239 pllpipt--------------------nlldvekkgvlpngiNYGSAVLLPHVPRILEFLKNKLqr-------------- 1284 Florida carp...
10_pfamImport  357 knppl------------------------lckeklstlkqslNYGSILLVPYIPDILELFQRKLs--------------- 397 
XP_001952794  1222 dip---------------------------lpslpseyedvlNVGSRLLYNYLPTILKYLYNELskk------------- 1261 pea aphid
XP_002063362  1199 -------------------------------------------eaLSLIRPYIPEILKHLQGNWqrk------------- 1222 Drosophila w...
EDQ86381      1488 gdsalpstdpttaavasntalagveededdnedaaeantdasvpSasntavgktrlKRFAPLDLSILSRLAPFATDADQA 1567 Monosiga bre...
XP_012551247  1293 ------------------------------------------akS-----------NTVNKRDLLILSRVTELVANPEIC 1319 domestic sil...
OWR44952      1289 ------------------------------------------akS-----------NTVNRRDLLILSRVTEMVTTPEMC 1315 Danaus plexi...
XP_969008     1253 ------------------------------------------knK-----------N-LNQRVLFILSWISELVWEADIS 1278 red flour be...
XP_001605633  1300 ------------------------------------------arQ-----------G-ASRTELVILSRISEFVSDSKTC 1325 jewel wasp
EFN80082       672 ------------------------------------------snK-----------G-VSRIELAILSRISEFVTDAETC 697  Jerdon's jum...
XP_011256579  1285 ------------------------------------------snR-----------G-LNKTELLILSRISEYVTDAETC 1310 Florida carp...
10_pfamImport  398 -------------------------------------------tK-----------QGLNRKEVEILSRMTELVTDPDSA 423 
XP_001952794  1262 ------------------------------------------rgV-----------G-LASIEMSILTRASELVRDQQSS 1287 pea aphid
XP_002063362  1223 ------------------------------------------tkK-----------QMLDRRELNILTLITSHVDDASTC 1249 Drosophila w...
EDQ86381      1568 VALTRLLMSQLLLpdrLLRVPsK---VHILRFALHAFDLfghaHGHLAALAQVLERSDSAQLRSLAAECIVAGAKFED-- 1642 Monosiga bre...
XP_012551247  1320 DELLTLLLPILVKk-vCMNMA-EenmEHAVTTIINLLGHstnpQSYIKHIAVLFNKVNQIDVRKLLIKLLQSIAEAAPkn 1397 domestic sil...
OWR44952      1316 DELLGLLLPILVKk-vCMNMA-EenmEHAVNTIINLLGHstkpENYIKNFAILFNKVGPVEVRKLLIKLLYSISENVSen 1393 Danaus plexi...
XP_969008     1279 DTTLKLLLPLALKr-cSTPIG-EeivVQLLTTISNLVGNvanpCAHLKQITPLFGEVSCASGRKILVKVLKICLKEFGp- 1355 red flour be...
XP_001605633  1326 DTLLTLVLPILQRk---sGDS-EevvMQLLTTVTNLLKHvdepKKHLRSIQHLLAQITAAPARKMLMQVLIGVARdd--- 1398 jewel wasp
EFN80082       698 DMLLALILPILIRk--aMHNN-EeavTELLTTVINLVKIvnrpEIHLRAIAPLMGLTSDISIRRLLIQLYNTIAEKSTge 774  Jerdon's jum...
XP_011256579  1311 DTVLKLILPILVKk--aSGNN-NeiiVELLTTVMNLIKMankpEIYLRDLAPLMSVVSDVPTRKLLLQLYGAIVERSSee 1387 Florida carp...
10_pfamImport  424 DKLLNLLIPRLIKk---sGSS-EdviIPLLSTAYNLIKYvinpGRYVRKLAPLYGSVEGPAARKLLFSIVIDLSKQEGse 499 
XP_001952794  1288 SNLLSLLFPVLLKk---aTGD-DmaiAPLFATVNCLVANvddvGSLPRQLATLYGTVIGQHSRNMLLEFTKIISKKSPns 1363 pea aphid
XP_002063362  1250 DLLLQLVLPIFSKq-vAGAGP-Em-vIQLITTLSNLLKRvkqpHIYVNQLAPLFELVQVISARKMLCEILTDMAKQLHka 1326 Drosophila w...
EDQ86381      1643 ------------MVdvAPVAADVLALQALdGTAAGeVPDYEARVSAFERLRARletKDvtLS-----APALQLLVqgtsH 1705 Monosiga bre...
XP_012551247  1398 ----------keTL--KRMAEIISEMNAFnKRWIE-QPDFDRRLDAYKRIYQLadnDEid------iDLAILIVN----N 1454 domestic sil...
OWR44952      1394 ----------keKY--EKIAHVVSEMNAFnKRWIE-QPDFDRRLDAYKSIYQMleaNEid------vDLAILIVN----N 1450 Danaus plexi...
XP_969008     1356 --------------------DLVDGLNAFdTKWLD-QPDFQRRHDAFKEVHKAideGRid------lDLGVLLAY----N 1404 red flour be...
XP_001605633  1399 -----------eQM--KKNQNLLAELNAYdQRWID-QPDFQRRLDAFSEIDRLikeEEat------lEFGVAVIL----N 1454 jewel wasp
EFN80082       775 n---------reTI--TRDCNVLIALNAWdHRWID-QPDFQKRLDAFGEINDMvekNTit------lEFGVAVIY----N 832  Jerdon's jum...
XP_011256579  1388 y---------reTM--MHDRDVLLALNAWdRKWID-QPDFERRLDAFDEISKMterNAis------lEFGVTVIH----N 1445 Florida carp...
10_pfamImport  500 ---------------sgLDEGLLGDLNAWdVKWID-QPDFNRRLNAFKKLEEManeKNis------vNLGIIVIY----T 553 
XP_001952794  1364 ----------------nIHCDILYNLNAWdKRHLD-QPDFDCRMNALKKIKDLldsNDis------vEFGAFVIY----N 1416 pea aphid
XP_002063362  1327 vkdqpqlsaqatAL--REWARIVYLLNAWdKRWIE-QPDYDKRLEALKEVKEMvaeEE--KKqqldmQLAILVVY----N 1397 Drosophila w...
EDQ86381      1706 MLC----SDDFTLRSIAATLFELLSATAERNPEFYpvL------IEGPCLRVLKRGVR 1753 Monosiga brevicollis MX1
XP_012551247  1455 CFYfirtEKDIGLRDSAGLCMKKILPKLLMKY-RS--AnegqflIRDTVLSLISTGIR 1509 domestic silkworm
OWR44952      1451 CFYfiktEKDIGLRDSAGLCLKKILPKLLIKY-RS--VpegtilVRDTVLSLISTGIR 1505 Danaus plexippus plexippus
XP_969008     1405 CYYllksEKDLSMKENSTHCLKQLCPYLINKYPKQ--Vdy---iLNDTIFNLVRNGMK 1457 red flour beetle
XP_001605633  1455 CFFflktENDLAMRDRSGQCLKSIGLYLAKKYSDN--StdrkylIEDTILTMVRHGIR 1510 jewel wasp
EFN80082       833 CFYflkaESDLAIRDYSGQCLKLVAPRLAKEHQNN--AvnrrylMDDTILVLTRRGIV 888  Jerdon's jumping ant
XP_011256579  1446 CFFflktASDLAIRDCAGQCLKLVGCRLAKEHCNN--SsnrrylMDDTILALTRKGIM 1501 Florida carpenter ant
10_pfamImport  554 CFFfvktEKDLSLKENSKYCLQKICPALCHSLQDN--NrdrnfvI-GTILYLVTKGLS 608 
XP_001952794  1417 CFYifnnVNDIGLRDTASTCLKNISCYLCLKYAKQ--SsertfiLDSVLLPSIRNGIQ 1472 pea aphid
XP_002063362  1398 CFYmlrhDNDLGLRVNIGELLKGLLPQLTIQL--A--EkdrnfwLDDILMPLFQRYIR 1451 Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap