4F99


Conserved Protein Domain Family
zf-DBF

?
pfam07535: zf-DBF 
DBF zinc finger
This domain is predicted to bind metal ions and is often found associated with pfam00533 and pfam02178. It was first identified in the Drosophila chiffon gene product, and is associated with initiation of DNA replication.
Statistics
?
PSSM-Id: 400082
View PSSM: pfam07535
Aligned: 105 rows
Threshold Bit Score: 47.4923
Threshold Setting Gi: 378754568
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4F99_B               88 GYCECCLQKYEDLETHLLSEQHRNFAQ-SNQYQVVDDIVSKL 128
Q9Y7J1              426 GYCENCCERYKDLERHLGGKHHRRFAEkDENFQGLDDLFLLi 467 Schizosaccharomyces pombe 972h-
EPY53994            415 GYCENCSERYRDLEKHLQGRRHKAFAEnNENFASLDEFFSQV 456 Schizosaccharomyces cryophilus OY26
XP_002174256        403 GYCENCCERFKDFEMHSMGRRHKLFAEtNSNFKNVDELLVKL 444 Schizosaccharomyces japonicus yFS275
XP_008073323         66 GFCEICYQKYASYDTHVRERTHREFALdSRNYKDIDDIIDSF 107 Vavraia culicis subsp. floridensis
EEQ82769             63 GFCEVCYNKFTDYDLHVREYEHREFARdSNNYKKIDHFISTT 104 Nosema ceranae BRL01
Q8SVH2               65 GFCEVCYVRFSNYEEHIKEFEHREFAKdNSNYKKLDTFISTS 106 Encephalitozoon cuniculi
EOB13909             24 GYCEVCYAKYNDYNQHVLEYEHREFAKdHSNFLKVDFFINNF 65  Nosema bombycis CQ1
WGS:AFBI:EDEG_01928  66 GYCETCFTHFKNYAQHILEEDHREFSYdEMNYNKVDFFIKEI 107 Edhazardia aedis USNM 41457
EPB81581            491 RFCENCNVLFENLEEHSKQQTHQTFIRdQNNFKELDELLAKT 532 Mucor circinelloides f. circinelloides 1006PhL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap