6MZM,5ECJ,2KNH


Conserved Protein Domain Family
TAFH

?
pfam07531: TAFH 
NHR1 homology to TAF
This corresponds to the region NHR1 that is conserved between the product of the nervy gene in Drosophila and the human mtg8b protein, which is hypothesized to be a transcription factor.
Statistics
?
PSSM-Id: 400078
View PSSM: pfam07531
Aligned: 33 rows
Threshold Bit Score: 92.6634
Threshold Setting Gi: 557016178
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6MZM_D        532 NVKKCKNFLSTLIKLAssGKQ-STETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPD 610  human
XP_010716551   51 QLSKLKRFLTTLQQFG--NDI-SPEIGERVRTLVLGLVNSTLTIEEFHAKLQEATNFPLRPFVIPFLKANLPLLQRELLH 127  turkey
Q61909         95 QLSKLKRFLTTLQQFG--NDI-SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLH 171  house mouse
XP_003242961  122 NHSKLKRFLTTLVQFS--GQI-SPQTSERVKGQIFTLVNNLISVEEFHHHIQEMTNFPLRPFVLPFLRTHLPSLQRDLLL 198  pea aphid
XP_002428748   91 NLGKLKRFLSTLVQFG--AEI-NSELGDKVRNLVFSMVNGNLTIEEFHTNLQDATNFPLRPFVLPFLKTHLPLLQKELAF 167  human body louse
XP_002043037  269 LVSKMRKFLGALVQFS--QELgQPEVSERVRALVLSLCSGSISVEEFRLALQEAINLPLRPYVVPLLKNSIALVQREILA 346  Drosophila se...
Q17EZ2         81 KLLKIRRFLGALVQFG--QDT-NVDIGDRVRSLVLSLASGGLTVEEFQIAVQEATNFPLRSNVVPFLKSHVPVLQREITI 157  yellow fever ...
5ECJ_A        209 QLSKLKRFLTTLQQFG--NDI-SPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLH 285 
2KNH_A          9 QLSKLKRFLTTLQQFG--NDI-SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLH 85  
XP_006008532    1 -----------------------------------MHQNSTLTIEDFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLY 45   coelacanth
6MZM_D        611 SAAFIQQSQQQP 622  human
XP_010716551  128 CARMAKQSPAQY 139  turkey
Q61909        172 CARLAKQNPAQY 183  house mouse
XP_003242961  199 MARNNKQTLSQY 210  pea aphid
XP_002428748  168 QARIAKQSTSQY 179  human body louse
XP_002043037  347 LARATNQSALQY 358  Drosophila sechellia
Q17EZ2        158 LSRASKQTPTQY 169  yellow fever mosquito
5ECJ_A        286 CARAAKQTPSQY 297 
2KNH_A         86 CARLAKQNPAQY 97  
XP_006008532   46 CARLAKQTPAQY 57   coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap