6IGM,6LTH


Conserved Protein Domain Family
HSA

?
pfam07529: HSA 
HSA
This domain is predicted to bind DNA and is often found associated with helicases.
Statistics
?
PSSM-Id: 400077
View PSSM: pfam07529
Aligned: 156 rows
Threshold Bit Score: 36.3739
Threshold Setting Gi: 1253282148
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6IGM_H        127 VPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERARREEQAKLRRIAS 196 
Q6CJ38        427 yYKEQSKHTFQDHLVNQGIVLSKSFQDSRRSQIAKARRVAQIIESHFKHIAGAEERKLKEEEKRKKNLAR 496  Kluyveromyces lactis NR...
Q759G7        324 FYQEQEKHTLRDHLNNHGVVMSRMFQDRKRGRIARARKISQMIEQHFKHVAGAEERKTKEEEKRRRALAR 393  Eremothecium gossypii A...
XP_002553633  301 FYKEQQQYTFQDHLINQGIVMSRAFQETKKARISRIRKITQMIEQHFRHIAGAEERRQKEEEKRLKTMAR 370  Lachancea thermotoleran...
Q6FK48        347 MYKEQNLHIHQEHLINQGLFSSKLVQNRKKQRIAGAKKIAQMIEQHFKHIAGAEDRRLKENEKQRKAIAr 416  [Candida] glabrata CBS 138
CCC70789      323 hYKEQNLSVHREYLINHGIYMSKLFASGKRARIARAKKVSLMVEQHFKHLAGADERKLKEEERHRKLlar 392  Naumovozyma castellii C...
XP_003957215  311 ilKEQHIHTHRDYLLNQGIHMSKMFQNSRRARIARAKKVSQMIEQHFRHIAGAEERKEKDEERHKKALAR 380  Kazachstania africana C...
EKD00446      431 vgPPPRATDFQDSLMSHMVQVRNAMIYEAKMKPQVCKRIARGIQLYWEHIQNKDERERQAQEKERKRKAk 500  Trichosporon asahii var...
XP_001731001  417 phDPPRSKAHWDFVLDGVVACAQRMRHLSKHRMQLAKKVSRMVSAYWERALHSDEREQKMEWRRQRALAk 486  Malassezia globosa CBS ...
CCF50277      596 ahKKPRTKSHQDHLLEAVAASYPQIRQFARHKQQNARKVARIVAQHWERQLGTSQREKKAEERRIRALAk 665  Ustilago hordei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap