Conserved Protein Domain Family
Trehalase_Ca-bi

?
pfam07492: Trehalase_Ca-bi 
Neutral trehalase Ca2+ binding domain
Neutral trehalases mobilise trehalose accumulated by fungal cells as a protective and storage carbohydrate. This family represents a calcium-binding domain similar to EF hand. Residues 97 and 108 in S. pombe ntp1 have been implicated in this interaction. It is thought that this domain may provide a general mechanism for regulating neutral trehalase activity in yeasts and filamentous fungi.
Statistics
?
PSSM-Id: 400049
View PSSM: pfam07492
Aligned: 48 rows
Threshold Bit Score: 52.2036
Threshold Setting Gi: 332170296
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007873806   82 MEVLLKNEDTDGNMQITIEDSGPKVLTLGT 111  Pneumocystis murina B123
XP_006696558  104 LESLLKMEDTDQNMQITIEDNGPKVLTLRT 133  Chaetomium thermophilum var. thermophilum DSM 1495
EKD13758       77 IEQLQGQEASEGRCQITIEDNGPKVIYLGT 106  Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ELR10723       96 LENLQKQEDTDNNFQITIEDNGPKVISLGT 125  Pseudogymnoascus destructans 20631-21
EHY58424       87 LKDLIEREDIDGNQQITIEDNGPKHISLGT 116  Exophiala dermatitidis NIH/UT8656
CCE61521      153 LKELLLTEDTDSNYQITIEDKGPKVLRIGT 182  Tetrapisispora phaffii CBS 4417
XP_002555749  134 LEQLLNREDTDKNFQITIEDTGPKTIRIGT 163  Lachancea thermotolerans CBS 6340
EEQ40223      109 LEQLLQSEDTDHNYQITIEDTGPKVLRLGT 138  Clavispora lusitaniae ATCC 42720
Q6BXI7        186 LKELLKNEDTDHNFQITIEDNGPKVIKLGT 215  Debaryomyces hansenii
CCD55088       85 LEALRKQEDTDDNHQITIEDVGPKSLPLGT 114  Botrytis cinerea T4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap