1EHI,3LWB,4C5B


Conserved Protein Domain Family
Dala_Dala_lig_C

?
pfam07478: Dala_Dala_lig_C 
Click on image for an interactive view with Cn3D
D-ala D-ala ligase C-terminus
This family represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme EC:6.3.2.4. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF).
Statistics
?
PSSM-Id: 400040
View PSSM: pfam07478
Aligned: 13 rows
Threshold Bit Score: 244.909
Threshold Setting Gi: 6225246
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EHI_B 142 LLTVNGIRNTKYIVVDPESANNWS------WDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLI 215 Leuconostoc mesentero...
Q47758 138 LLQTVGIPQVPFVPVLRSDWKGNPke---vFEKCEGSLIYPVFVKPANMGSSVGISKVENREELQEALEEAFRYDARAIV 214 Enterococcus faecalis...
P73632 134 VFERAGLPQVNYMGVERGEIWSNPcvfpalCEKIEAQVGYPCFVKPANLGSSVGIAKVRNRSELEAALDNAASYDRRIIV 213 Synechocystis sp. PCC...
P96612 135 LFAQVGLAQAKYAAFLKKDWTRSPke---sCEEVEQELGYPCFVKPANLGSSVGISKCRNREELQKAFELAFQYDRKVVV 211 Bacillus subtilis sub...
P0A6J8 147 LLRDAGLNIAPFITLTRANRHNIS------FAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIV 220 Escherichia coli K-12
O84767 569 FMSDLGIPVVPYLPLTLAGWKQEQdk---wLAHIVEAFSFPIFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFV 645 Chlamydia trachomatis...
3LWB_A 158 LLAADGLPVGAYAVLRPPRSTLHR--------QECERLGLPVFVKPARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIV 229 Mycobacterium tubercu...
Q06893 138 LTKNAGIAVPEFQMIEKGDKPEAR------------TLTYPVFVKPARSGSSFGVTKVNSTEELNAAIEAAGQYDGKILI 205 Enterococcus faecalis...
O66806 101 IVKSLGINTPDWETFISEGDVLNT-----------EWNKFPAVVKPVREGSSVGLKIVESLEELKEYALDLLKKTERVMV 169 Aquifex aeolicus VF5
4C5B_B 127 LWQGAGLPVAPWVALTRAEFEKGLsd---kQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLI 203 Escherichia coli K-12
P44405 106 LWKAFGLPVADMKVVTRETFSELD------PQAVVAKLGLPLMVKPSLEGSSVGLTKVKAVEELKSAVEYALKFDNTILI 179 Haemophilus influenza...
O51218 136 LLKSFDIPLVPFIGFRQHDYFLDKee---iKRNVKEVLGYPVIVKPAVLGSSIGINVAYSENQIESFIKEALKYDLTIVI 212 Borreliella burgdorfe...
O83676 143 LWQAAGLPVLPFVFFRKDAWRMHMqe---fVAQLETRLGYPLFVKPAQAGSSVGASAVQTRAPLIPAIEAAFQWDEVVLV 219 Treponema pallidum su...
1EHI_B 216 EEAVnGARELEVGVIG--NDQ-PLVSEIGAHTVPNqgs-gdGWYDYNNKF---VDnSAVHFQIPAQLSPEVTKEVKQMAL 288 Leuconostoc mesentero...
Q47758 215 EQGI-EAREIEVAILG--NED-VRTTLPGEVVKDV------AFYDYDAKY---IN-NTIEMQIPAHVPEEVAHQAQEYAK 280 Enterococcus faecalis...
P73632 214 EAGLtDIREVECAVLG--NEN-PQASVVGEITYDS------DFYDYETKY---TD-GRSQMHIPANLPKAVVNQIQTMAI 280 Synechocystis sp. PCC...
P96612 212 EEGI-NGREIEIGVLG--NDD-PKCSVVGEIAPKT------DFYDYKAKY---ED-GDTDLMIPAIVTDEEYATISDMAI 277 Bacillus subtilis sub...
P0A6J8 221 EQGI-KGREIECAVLG--NDN-PQASTCGEIVLTS------DFYAYDTKY---IDeDGAKVVVPAAIAPEINDKIRAIAV 287 Escherichia coli K-12
O84767 646 EENRlGCKEIEVSVLGdgSGA-FVVAGLHERRGSG------GFIDYQEKYg-lSGkSSAQIVFDTDLSKEIQEQILEAAD 717 Chlamydia trachomatis...
3LWB_A 230 EAAI-SGRELECGVLEmpDGT-LEASTLGEIRVAGvrgredSFYDFATKY---LD-DAAELDVPAKVDDQVAEAIRQLAI 303 Mycobacterium tubercu...
Q06893 206 EQAI-SGCEVGCAVMG--NEDdLIVGEVDQIRLSH------GIFRIHQENepeKGsENAMIIVPADIPVEERNRVQETAK 276 Enterococcus faecalis...
O66806 170 EEFV-EGRDMTVGILK------GEALPVVEIIPKK------GVYDYECKY------TKGMSEYRILKDEKLSKKLQEISL 230 Aquifex aeolicus VF5
4C5B_B 204 EKWL-SGPEFTVAILG------EEILPSIRIQPSG------TFYDYEAKYl----sDETQYFCPAGLEASQEANLQALVL 266 Escherichia coli K-12
P44405 180 EEWL-AGDELTVPVLD------NQVLPAIRIVPEG------EFYDYEAKYi----sDNTQYFCPAGLTPEREQALSTLVK 242 Haemophilus influenza...
O51218 213 EKFI-EAREIECSIIG--NEK-MKIFSPGEVVVQDf-----IFYDYDAKYs-vIPgNSIIFNIPAHLETNQLLSIKEYAF 282 Borreliella burgdorfe...
O83676 220 ERYV-RAREIECALSG--NGP-YTVHGAGEVIAQG------AFYDYEEKY---ADaSVARVLVTAPLETAQYEQITTLAL 286 Treponema pallidum su...
1EHI_B 289 DAYKVLNLRGEARMDFLL-DENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLID 349 Leuconostoc mesenteroides
Q47758 281 KAYIMLDGSGLSRCDFFL-TSKNELFLNELNTMPGFTDFSMYPLLWENMGLKYSDLIEELIQ 341 Enterococcus faecalis V583
P73632 281 QAFKAVDAAGLGRLDFFYqPTTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQ 342 Synechocystis sp. PCC 6803 substr. Kazusa
P96612 278 KAFKAIDGSGLVRADFFL-TADGEVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVE 338 Bacillus subtilis subsp. subtilis str. 168
P0A6J8 288 QAYQTLGCAGMARVDVFL-TPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIE 348 Escherichia coli K-12
O84767 718 KIYRLLLGKGSCRIDFFV-DEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLVI 778 Chlamydia trachomatis D/UW-3/CX
3LWB_A 304 RAFAAIDCRGLARVDFFL-T-DDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIE 363 Mycobacterium tuberculosis
Q06893 277 KVYRVLGCRGLARVDLFL-QEDGGIVLNEVNTLPGFTSYSRYPRMAAAAGITLPALIDSLIT 337 Enterococcus faecalis V583
O66806 231 KISKFLSLKDFARIDFRV-TKEGKIFFLEVNTIPGMTELSLLPMAAKEKGMDFKKLISIIIT 291 Aquifex aeolicus VF5
4C5B_B 267 KAWTTLGCKGWGRIDVML-DSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILE 327 Escherichia coli K-12
P44405 243 RAYDAVGCRGWSRIDVMC-DAKGNFRLVEVNTNPGMTSHSLFPKSAATVGISFEQLVVKILE 303 Haemophilus influenzae Rd KW20
O51218 283 LTYKNLELRGMARVDFFVeKKSGTIYLNEINTIPGFTDISMFAKMCSNDGLQFKDLVDNLID 344 Borreliella burgdorferi B31
O83676 287 RAYEALGLTGLARVDFFL-LETGEVYVNEVNTMPGFTSISLFPQICQAAGVAPQDLMAQLLS 347 Treponema pallidum subsp. pallidum str....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap