Conserved Protein Domain Family
Phage_Nu1

?
pfam07471: Phage_Nu1 
Phage DNA packaging protein Nu1
Terminase, the DNA packaging enzyme of bacteriophage lambda, is a heteromultimer composed of subunits Nu1 and A. The smaller Nu1 terminase subunit has a low-affinity ATPase stimulated by non-specific DNA.
Statistics
?
PSSM-Id: 369382
View PSSM: pfam07471
Aligned: 3 rows
Threshold Bit Score: 178.694
Threshold Setting Gi: 81546763
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31061   1 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIRWYAERDAEIENEKLRREVEELRQASETDLQPG 80  Escherichia coli K-12
Q8ZMZ2   1 MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDASIENEKLRKEVDDLRAAAESDLNPG 80  Salmonella enterica s...
Q9P9S6  23 KQVNRAGLSEIFGVALPTVDQWARNGCPVVKRGGRGREWAFDTAVVARWLRDKAAE-------------EAAGEAVAD-- 87  Xylella fastidiosa
P31061  81 TIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSRIAGEIASILDGIP-----LSV----QRRFPELENRHVDFL 151 Escherichia coli K-12
Q8ZMZ2  81 TIDYERYRLTKAQADAQELKNAEREGLVLETELFTYILQRVAQEIAGILSRVP-----LVL----QRKYPDLCQSHIDVV 151 Salmonella enterica s...
Q9P9S6  88 -IEEWKRRKIAAEAQREELHLADAKKQVAPLEQVEKTLARVFAEVRANLRTIPgrtvaLLLgetdERRYKR-------VL 159 Xylella fastidiosa
P31061 152 KRDIIKAMNKaaA 164 Escherichia coli K-12
Q8ZMZ2 152 RTEIARASGR--A 162 Salmonella enterica subsp. enterica serovar Typhimurium
Q9P9S6 160 LQEIDQTLENlaS 172 Xylella fastidiosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap