Conserved Protein Domain Family
DUF1518

?
pfam07469: DUF1518 
Domain of unknown function (DUF1518)
This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins.
Statistics
?
PSSM-Id: 400033
View PSSM: pfam07469
Aligned: 22 rows
Threshold Bit Score: 41.2667
Threshold Setting Gi: 1033372882
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016848931 1265 SMDGAVAGPPMAPVPPQQFSYPSNYGMNQPPDPAFSRVSSPPNPLMAQRMGPSQNPMM 1322 green anole
XP_015140592 1282 SVGGQFGTGMTPQMQQNIFQYSGS-GMGQQNEPTFAPSLSPSSPLMSPQLPPSQSPML 1338 chicken
XP_007476987 1107 NVGGQFGTGINPQMQQSVFQYPGS-GLGQQSEPNFTPSLSPGSPMMSLQIPPSQSPML 1163 gray short-tailed opossum
XP_014341047 1267 NVGGQFAAGMNSQIQQNVFQYSAS-GMGQQADPPFAPAMSPNSPMMSPRIPPSPSPML 1323 coelacanth
B5DE09       1288 GIPASINSPRIPQGNTQQFPFPPNYGMSQQSDPGFTGATTPQSPIMSPRMGHIQSPMM 1345 tropical clawed frog
KAE8598978   1358 SMGGQYGPVMNPQMQHNAFQFANS-GMSQQSDPGFTGATTPQSPIMSPRMGHIQSPMM 1414 tropical clawed frog
KAE8605532   1273 NVGGQFGSGINPQMQQNVFQYSAT-GISQQGDPTFAPSLSPTSPLMSPRITPSQSPML 1329 tropical clawed frog
XP_024098234 1212 NMGGQFGTGINPQMQQNVFQYPGA-GMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLL 1268 Sumatran orangutan
XP_015209106 1358 NIGGQFGAVMSPQMQHNAFQFPSS-GMNQQPDAGFGGATTPQSPLMSPRMGHAQSPMM 1414 spotted gar
XP_029698357 1285 matGGISNPRIPQANPQQFPYPPSYGMSQQADGGFGGTGTPQSPLLSPRMAHAQSPMM 1342 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap