Conserved Protein Domain Family
ApoLp-III

?
pfam07464: ApoLp-III 
Apolipophorin-III precursor (apoLp-III)
This family consists of several insect apolipoprotein-III sequences. Exchangeable apolipoproteins constitute a functionally important family of proteins that play critical roles in lipid transport and lipoprotein metabolism. Apolipophorin III (apoLp-III) is a prototypical exchangeable apolipoprotein found in many insect species that functions in transport of diacylglycerol (DAG) from the fat body lipid storage depot to flight muscles in the adult life stage.
Statistics
?
PSSM-Id: 369376
View PSSM: pfam07464
Aligned: 12 rows
Threshold Bit Score: 116.691
Threshold Setting Gi: 501596775
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002431066  39 KAKEFGEHITKMLGld-sLPSGNEVVELIKTQAKNFADQAEQVQHQFDDELKRlTNstvAESFSEFNKKVQETVASFRSq 117 human body louse
Q16XP1        43 AIEDTHQGVQKVLG----YQLDQEVLRAIKNNTDELARKLKNISSTVKEQATK-YG---EPALREVIDDIVNMADKISK- 113 yellow fever mo...
EGK96965      49 VFQETQQNVLKSLG----FQSNEEVVQTIQTNTNQYVERLRSVQGVIEEEVKK-NSdifEPILKDLNTKLAQTTATLSE- 122 Anopheles gambi...
EDS29975      49 ALADTQQSVLKALG----FQSNEEVVETIQKNTGKYVDQLKTIQATIQEEAAK-HSnifDPIVKDLNAQIAQTRQKLSE- 122 southern house ...
Q16XP0        48 ALTGLNQSVLKSLG----FQSNDEVVETIQKNTNKYVEQLKTVQASLDEELKK-HSgilDPVVKQLNEKIEETRKSLTE- 121 yellow fever mo...
WP_012597818  97 TVEEIKPSVKETVN------SLKQTVEEVKPSVSGAVDSVRQTIDETRPSMKK-AIdaaTETIDETRPAIVETADTVKEt 169 Gloeothece citr...
NP_001037078  34 HTKEFHKTLEQQFNsltkSKDAQDFSKAWKDGSESVLQQLNAFAKSLQGALGD-ANgkaKEALEQSRQNIERTAEELRK- 111 domestic silkworm
OWR54858      34 HAQEFQKIFNDQLNaltsSKNTEEFNKVLKEGSESVLSQISALSGSLQSALKE-ANgkaKEALEQAQANLQRTAEDLRK- 111 Danaus plexippu...
XP_011064262  48 LINNLSAQLQQQ------LPNQQDVNTAIKEGTTNLVSNVQMFFKNMSDEIKA-KSpelESVWTNMKNKLSETFNNLNV- 119 Panamanian leaf...
EFN69578      48 IFSNLGNQIEQH------LPNQDEFLKTLKEYSTGLVNNINEYIKNATEEVKT-KSpelESVWTNFKTKLSEATDKLNI- 119 Florida carpent...
XP_001602474  40 NINDLAANIKTQLN----IPDQETVVNTIKNQSSTFVNNVQSYISSVSEDVKN-KTpelEKLWTDVKSKLTKVVEDINA- 113 jewel wasp
ABY82793      45 niNNLAKQIQEQWN----IPDQDTIVKTVKDQSANFVNNIQDYIKNVTEEVKT-KTpelERSWNDVKTMLNKVVDDISS- 118 honey bee
XP_002431066 118 --lESSGMVEKASELQGKFQTGLTALFEESKKLASDLEPQMVGAGAELENLTKKVLNEAVESLNQLQTQLH 186 human body louse
Q16XP1       114 ---EDPETAKKAQDYLANVQSNIFMLITQVAALDARIDREKQAATNELQDTIVQLYLAATDAARKTTEALE 181 yellow fever mosquito
EGK96965     123 ---QNPEVVQKAKEYQAQVQSNVQALVAEAQKTVEKLKEDTRVPTENIQDALKKLYDYTFETLTKTANELK 190 Anopheles gambiae str. PEST
EDS29975     123 ---QNPELVQKAQVYQQTVQANIQSLATEAQKAGERIKEEGRGASEQLQAALKQLYDVTFQTLQKTTQELE 190 southern house mosquito
Q16XP0       122 ---KNPELVQKAQEYQESVQTRIQSLLTEAQKTGEQLKESSRGATEQVQTALKQLYDATVDTLQKTVKELE 189 yellow fever mosquito
WP_012597818 170 vkdARPAVKKAVDKTSESIQSSTESLAKSVQGAGESVKDAAQEAKPKMRRAMESVSDDVQSSASKVADSVK 240 Gloeothece citriformis
NP_001037078 112 ---AHPDVEKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIKKIQ 179 domestic silkworm
OWR54858     112 ---SHPEVEQQANALKAKLQDAVSKTVSETQKLVKEVSANIEQTNQKLTPKIKEAYDDFVKQAEDVQKKLH 179 Danaus plexippus plexippus
XP_011064262 120 ----NPETTEQINQLSTKFQESVQTLVSESENAAKTISENSSKVQEGIAKFTKQAIDIAVQASQNLSNQLQ 186 Panamanian leafcutter ant
EFN69578     120 ----DAETTEQLNNLNNKFQEGVRTILTESENTAKAINENSAKVQEGISKLTKQAIDIAVQASQNLSNHLQ 186 Florida carpenter ant
XP_001602474 114 ---SVPNAKESAEQLQKQFQEGVQTLVKESNTIAESFKQNSGTVKEEIAGFTKKAVDIAVEATHNLNEQLK 181 jewel wasp
ABY82793     119 ---GIPNAQQQVAELQSKFQQGVQTLLKESDKAAKSLSQHSGKIQEDLAKFTKQAVDIAVQATQNLNNQLQ 186 honey bee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap