Conserved Protein Domain Family
SPAN-X

?
pfam07458: SPAN-X 
Sperm protein associated with nucleus, mapped to X chromosome
This family contains human sperm proteins associated with the nucleus and mapped to the X chromosome (SPAN-X) (approximately 100 residues long). SPAN-X proteins are cancer-testis antigens (CTAs), and thus represent potential targets for cancer immunotherapy because they are widely distributed in tumors but not in normal tissues, except testes. They are highly insoluble, acidic, and polymorphic.
Statistics
?
PSSM-Id: 400025
View PSSM: pfam07458
Aligned: 7 rows
Threshold Bit Score: 114.643
Threshold Setting Gi: 1099312979
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5MJ09         1 MEQPTSSTNGEKTKSPCESNNkKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKI---NSNQLENEQSQENS 77  human
Q5MJ10         1 MEQPTSSTNGEKRKSPCESNNkKNDEMQEAPNRVLAPKQSLQKTKTIEYLTIIVYYYRKHTKI---NSNQLEKDQSRENS 77  human
EHH31148       1 MEQPTSSTNGEKRKSPCESNNnKNDEMQETPNRDLAPKQSLKKTKTSEYPTLLMFPYKKFKKI---SSSQVENYQSPGNT 77  Rhesus monkey
XP_002831714   1 MEKPTSSTNGEKRKSPCDSNN-RNDEMQETPNRDLALEPSLKKMKTSEYSTVLVLCYRKTKKI---HSNQLENDQSQENS 76  Sumatran orangutan
Q6SJ90         1 MDE-KSRAGGVKRSAPCDSNE-ANEAMPETQSGDSHPQPAPKKLKTSESSTTIVLSYRRNVKIt--SAQELVNDHARENR 76  chimpanzee
Q9NS26         1 MDK-QSSAGGVKRSVPCDSNE-ANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRt--SPEELLNDHARENR 76  human
XP_018874584   1 MGQ-QASAGGVKRSTPCASNE-AGETMPETPSGDSDPQPAPKKLKTSDSSTIVVVRHRRKVKRrysVSDELVNDHSRENG 78  western lowland...
Q5MJ09        78 INPIQKEEDEGVDLSEGS 95  human
Q5MJ10        78 INPVQEEEDEGLDSAEGS 95  human
EHH31148      78 IYPIQEEEEEDLDSFEGS 95  Rhesus monkey
XP_002831714  77 VNPVQEEEDEGSSQEDED 94  Sumatran orangutan
Q6SJ90        77 INTLQMEEEEFIEITTEI 94  chimpanzee
Q9NS26        77 INPLQMEEEEFMEIMVEI 94  human
XP_018874584  79 INPLQMEEKEFMEIRVET 96  western lowland gorilla
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap