2HFD,2ES7


Conserved Protein Domain Family
HyaE

?
pfam07449: HyaE 
Click on image for an interactive view with Cn3D
Hydrogenase-1 expression protein HyaE
This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long. This includes the E. coli protein HyaE, and the homologous proteins HoxO of R. eutropha and HupG of R. leguminosarum. Deletion of the hoxO gene in R. eutropha led to complete loss of the uptake [NiFe] hydrogenase activity, suggesting that it has a critical role in hydrogenase assembly.
Statistics
?
PSSM-Id: 400018
View PSSM: pfam07449
Aligned: 6 rows
Threshold Bit Score: 150.669
Threshold Setting Gi: 30179611
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HFD_A               18 GWTPVS-ESRLDDWLTQ----APDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIA-DLEQSEAIGDRFGVFR 91  Escheric...
Q7CQJ3               16 GFLVTD-AQTLPSLINA----HPTLLVLLQSDPNKHPEVADSWVIIPEILKQFPATSYTAAFA-DSEQSELIAREYRILK 89  Salmonel...
P31910               30 QAAWVD-QDSIDDWLAG----GGDCVLFIAGDPVRFPECVDVAVVLPELQRVFFNGFRIGVAKrEREHEDVLANRFGTQR 104 Cupriavi...
2ES7_C               18 GWQPVE-ASTVDDWIKR----VGDGVILLSSDPRRTPEVSDNPVXIAELLREFPQFDWQVAVA-DLEQSEAIGDRFNVRR 91  Salmonel...
rhodo:RCAP_rcc00772  28 GWPRLEnAHDLREFTTR----PGAHCLFVPGDAARNLETPDAAVVLPELRQAFQNAFDCAVVG--DGIETELRETTRVLK 101 Rhodobac...
P48339               14 GLNEVD-AATVDHFLGAadeaGAIAVLLSAGDPNRFPEATDVAVVLPELIAAFGGRLRGAVIA--RGDESALGQRFGVRV 90  Bradyrhi...
2HFD_A               92 FPATLVFTGGNYRGVLNGIHPWAEL 116 Escherichia coli
Q7CQJ3               90 YPALLFFRQHRFVGSLAGLYSWQEY 114 Salmonella enterica subsp. enterica serovar Typhimurium
P31910              105 RPSLVFLRDGAYVSVIAGMRDWDEY 129 Cupriavidus necator H16
2ES7_C               92 FPATLVFTDGKLRGALSGIHPWAEL 116 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rhodo:RCAP_rcc00772 102 TPSFLFFRDGDFLGGIEKIRDWDDY 126 Rhodobacter capsulatus SB 1003
P48339               91 QPTLIFVAKGETLGLIAKIQDWSVY 115 Bradyrhizobium diazoefficiens USDA 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap