Conserved Protein Domain Family
Ycf66_N

?
pfam07444: Ycf66_N 
Ycf66 protein N-terminus
This family represents the N-terminus (approximately 80 residues) of Ycf66, a protein that seems to be restricted to eukaryotes that contain chloroplasts and to cyanobacteria.
Statistics
?
PSSM-Id: 400015
View PSSM: pfam07444
Aligned: 39 rows
Threshold Bit Score: 75.6675
Threshold Setting Gi: 428015968
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Riv7116_0501  334 ILLGVSLAAFGSGLFFLRSLYPKLARDYDAVFGIILFLSGILLLFQEFKsyRSQEVPIAQFMLTAACFYSIAESVHLR 411 Rivularia sp...
jgi:Syn7502_02324  11 ILLAIIAALGGIGLYFVRSFRPELARDHDIFFSAIALVYGIILLAFNFR--MEITTQLAQVLVVGFAGWFAVESLILR 86  Synechococcu...
Q2JKJ3              9 FLMAALVAIASGAIFAVRFIKREASAEYDVIFATMGLIYSVCLLLEGQR--LIPLLFFAQVLLAVMAGWFAIETFRLR 84  Synechococcu...
Q6YXR7             10 TIVGIGLIVVGILLYALRIREPNVSRDYDSFFSSIGLLCGGILIFQGWR--LDPILLLSQILLSGTAIFFIVESLYLR 85  Physcomitrel...
jgi:OSTLU_9568     10 VVLGSSLMISAIALYQVRAARPEVSRDKDVFFSSIGLLCGGILIFQGWR--LDPLMLFGQLLTTATAVAFATETISLR 85  Ostreococcus...
EFN51373           10 VVLGVGLIGAGVSLWQIRRVKPWISKDYDVVVSCISLLVGGILIFQGWR--LDPLLLFGQLMTTGAAVSFAIEALRLR 85  Chlorella va...
WP_015171534       10 SIVGIALVIGGAALYAVRTVRPELARDYDIFFAAVALLSGAIFFFQGWR--FDPIMQFGQILLGGSAIFFAFESVRLR 85  Geitlerinema...
ABK20623           10 IFLGIIVSLGVLILYFLRNVKPEVARDEDIFFATIGLLYSCILMIHGWR--LDPILLFSQVLIIVTVLVAGWENIRLR 85  Phaeodactylu...
YP_003289223       10 FLLGLLIILGVLILYFLRSVRPELSRDEDIFFTTLGLIYGAILIIHGWR--LDPILLFSQVLLVSLVLAAGWENIRLR 85  Ectocarpus s...
tgen:AM1_2119       9 LIVGVILIVGAIALFFLDKIKPGYRRDSDNVYAFLGLLAGVILLAHLG---MEFTLSLQQMIVVGMLVALMIENIQNR 83  Acaryochlori...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap