Conserved Protein Domain Family
Curto_V3

?
pfam07436: Curto_V3 
Curtovirus V3 protein
This family consists of several Curtovirus V3 proteins of around 90 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369364
View PSSM: pfam07436
Aligned: 2 rows
Threshold Bit Score: 137.865
Threshold Setting Gi: 81962727
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_001715617  2 MVCIPDWLFLLFVFSTILQSGINFYGTFQSERISAKLSSLASRFDELFLALQQVVFARNRvSSSRAVDSRGRRGLSSIPE 81  Beet curly top I...
Q91J29        2 MVCLPDWLFLLFIFSILLQSGTNFYGTFQSGSISRQLSSLSSSIDQLFLKVQQVVYTRYP-SRDRVSDPRRRRGLSSIPE 80  Beet curly top v...
YP_001715617 82 GSEEIAE 88  Beet curly top Iran virus
Q91J29       81 GSEEATE 87  Beet curly top virus - California [Logan]
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap