Conserved Protein Domain Family
Dynactin_p22

?
pfam07426: Dynactin_p22 
Dynactin subunit p22
This family contains p22, the smallest subunit of dynactin, a complex that binds to cytoplasmic dynein and is a required activator for cytoplasmic dynein-mediated vesicular transport. Dynactin localizes to the cleavage furrow and to the midbodies of dividing cells, suggesting that it may function in cytokinesis. Family members are approximately 170 residues long.
Statistics
?
PSSM-Id: 400005
View PSSM: pfam07426
Aligned: 27 rows
Threshold Bit Score: 106.159
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EIE77774       6 FEARLRHLEYILYGQQQQQNKSTn---eVIIKRMELLRKELSSIYQNNKS--IKYFIEKCnldDTHSKLLN--PntsTYS 78  Rhizopus delema...
EFX73886       8 VEERLKRLEKYVLGEDVNRQDDE-----QLIDTMLAVSRKLASVVSKNEK--VSSALKRA---DEVKKYAD--P---LYA 72  common water flea
EFA03783       7 LEKRIAALELQVLPKNPNFASDDkt--qEITHLLLLTQTMISSALSCREA--ITSILQHM---TTINEYLD--P---SNG 74  red flour beetle
EFN76056       7 LEDRIANLEKQAYGPNKAVNIDDpaplnAVIDRLLDVNSLISSALSGREK--PNAVIKRL---PELNGYLD--P---VSE 76  Jerdon's jumpin...
EFN70786       7 LEDRIANLEKQVYGLGKTISIDDpvppnAIIERLLDVNSLLSSALSGREK--PNALIKRL---PELNGYLE--P---VPE 76  Florida carpent...
XP_011050498   7 LEERIANLEKQVYGLGKMMNIDDpappnAIIDRLTDVNSLISSALSGREK--PNALIKRL---PELNGYLE--P---TCE 76  Panamanian leaf...
XP_015785476  17 LEERVAMIEGLVMGSKANCDDEN-----SLVDPLLEIITKLRSLTASRDN--YNQLAKQY---EEYGDFIDklD---QFE 83  two-spotted spi...
CDS40448       6 LESRIYELERLILGASAMPLQTSsn--qTVSDLIADAQKQL-SLAEKYPK--IKEILERS---SELRKYMD--P---NFL 72  Echinococcus mu...
EPB89341       6 FEARLRHLEHVLLGQNNTQLKGSn---eTLIKRVEALQKELDAVYKNNKP--IRDFVTKY---DVHAKLLN--PntsTYT 75  Mucor circinell...
XP_011409697  17 LQRRLDLLEERLIGQEKVREGQP-----QLVHLLKTIDGKLKALVQSMKGncVQQVWDTI---PDLERILD--P---AYL 83  Amphimedon quee...
EIE77774      79 LERElLSTDVKIELLLAAQDDLKKFAQEVKQVKSLEHVVSGTELEVVDKLKPQLSSMDVIHVNQTKQLNQLTKEISDLME 158 Rhizopus delema...
EFX73886      73 ESEGfMPEAVKLQLLLSKEEDMKEALNHFQKMNLLKPVLDSQAIQNVPQLESQLYKISLQQESQEKKVSNLSDDTYALIK 152 common water flea
EFA03783      75 ENE--LEVEAKRHYLLELYPELKDTVKLISTFESLTPYTDSSSIIKVTELTDKLESLAVSNLKIFEESQEVTKKTVSALQ 152 red flour beetle
EFN76056      77 DIE--MPTSAKTQLLLTMESEIMENHKLLTKMQELMPVLESERIKDVPEFNNTFNKLSLSYLKAYEDSEELSAHVHDLLS 154 Jerdon's jumpin...
EFN70786      77 GFD--IPISAKAQLLLTMEPEIIENDKLLTKVQELAPILESERIKNVPELNSTFNKISLSYLKAYEDSKELSTHIHDLLS 154 Florida carpent...
XP_011050498  77 DVD--IPTSAKAQLLLTMEPEIIENHKLLNKVQELMPVLESERIKDAPELNNTLNKLSLSYLEAYEDSKELDAHVHDLLS 154 Panamanian leaf...
XP_015785476  84 GNV--EPDAVKWEHILAQEDKLRDKATLIESIVSKKDVVDSNALKDIDPLLPKLEKIRELLIRQDEQASKLSEETQDLIR 161 two-spotted spi...
CDS40448      73 DDQT-VANAAKIRIILSLEAEMLQTARALEALQSLKSVLNHPAYSDLSSLKAKFATIQQKHVEQEVQASDFIDESSQLLE 151 Echinococcus mu...
EPB89341      76 MEREiLAPDVKLELLLTANDDLEKFAQEVKQVKDLEYVVSGSEFE--ETLGPKLASLEVTHTDQISELNQITKQVSDFME 153 Mucor circinell...
XP_011409697  84 RSLN-LNAPAKKELLLYYVEQLQKYQNDIDDLQLLKETVNTTSYQGTEAVEKDLSQLAATHVQQEDEVVSLTSRVHLFID 162 Amphimedon quee...
EIE77774     159 RYNKTVNTVSEIFIA 173 Rhizopus delemar RA 99-880
EFX73886     153 NYSNFVNDVSKKLVE 167 common water flea
EFA03783     153 QYNDIISTIKVLFSQ 167 red flour beetle
EFN76056     155 KYNAVISSISESLIs 169 Jerdon's jumping ant
EFN70786     155 KYNAVISSISESLIT 169 Florida carpenter ant
XP_011050498 155 KYNAVINSISESLII 169 Panamanian leafcutter ant
XP_015785476 162 NYHQLMFRLKNKMIT 176 two-spotted spider mite
CDS40448     152 TYANTTRDMSKLLVA 166 Echinococcus multilocularis
EPB89341     154 RYNHTVNTLSEIFIQ 168 Mucor circinelloides f. circinelloides 1006PhL
XP_011409697 163 QYTKLILQLSAQCVE 177 Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap