Conserved Protein Domain Family
Na_H_antiport_3

?
pfam07399: Na_H_antiport_3 
Putative Na+/H+ antiporter
This family consists of several hypothetical bacterial proteins of around 440 residues in length. The function of this family is unknown. Many members carry 11 or 12 transmembrane regions, suggesting that they might be transporters. One family member, UniProtKB:Q821X2 is classified by TCDB as being an NhaE type of Na+/H+ antiporter.
Statistics
?
PSSM-Id: 399992
View PSSM: pfam07399
Aligned: 36 rows
Threshold Bit Score: 468.984
Threshold Setting Gi: 123496502
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA63271:OPIT5_01950  79 FNLVASIIFLLAIVHTFLTGRFRHWAHEAehahaaalrkrrqrlevtdnnhdgapdPV-SfkgQVLHFFGEVEAVFGIWV 157 Opitu...
jgi:Amuc_1617           88 FNLAVTLVFFGAIIHTFLAGRFERYSHKLalrykeklket-----nfrvmhpeerlPV-SfasAIFHFLGEVEAVFGIWL 161 Akker...
Q2IF09                  11 LNAVATALFLLAILHTFLAPRFLAASHRLrervea----------------ahgpgAH-SgkvEVLHFLGEVEAVFGIWV 73  Anaer...
jgi:Caka_1379           86 FNIVATIIFLMAVVHTFLASTFNKMAHKYehdhqewlkt-------hdkvyvdgkqPV-SfkgTLFHFLGEVEAIFGIWL 157 Coral...
WP_013182769            69 FNLISLIIFSLAIIHTFFAHYFTTLSKKWrarni-----------------rlgkdPVdSfgvEALRFMGEVEVVFGLWV 131 Waddl...
CCB85693                63 LSITANILLGIALVYNFLSRKVLALPDNWqkeqateqt----------vvlthsknPLkY----LSHYIKTIRRVFGIWI 128 Parac...
WP_014804891             9 MEATGAILFALAVLHTFFVGKFHDWAHNF---------------------------PHgSlrqNLIEFLAETEIVFGMWA 61  Turne...
WP_014245076             6 VQLVGTILFVCAVLHTFLVSKFEHLAHKY---------------------------PKgSmgeNIFHFLGEVEAVFGMWA 58  Halob...
Q6MK29                   6 IELIGTILFGLAVIHTFMVGRILAWSHHF---------------------------PKdSlwsNFLHLLGEIEAVFAIWA 58  Bdell...
OUHSC:BDW_09435          6 IELLGTIFFGVAVIHTFLVGKFLQISHRY---------------------------PQdSmgrHVFHLLGEIEAVFAIWA 58  Bdell...
PRJNA63271:OPIT5_01950 158 LVLAAAI-----LAD--KGWN------AVTGYIGhQVNFTEPMFVVVIMAMASTAPILRFAERGLQQVAS-----LGGRS 219 Opitu...
jgi:Amuc_1617          162 IPFMFVC-----WKY--YSFE------DFSAYLNyDCSFTEPMFVMIIMIIASSRPIFKLAEYVVNCGAR-----LGKAT 223 Akker...
Q2IF09                  74 LPLMIAI-----TVA--KGSK------TAEAFLG-RVNFTEPLFVVVVMALASTRPVLSFAEAVMGRVAR-----LGGGT 134 Anaer...
jgi:Caka_1379          158 IPLLICM-----VFMqdHGIN------IVSHYID-TRNYTEPIFVVIIMAIASSRPVIQFAETCMRVVAN-----FGKGT 220 Coral...
WP_013182769           132 IPLFLAI-----AFS--YSWD------TAVRYVE-NIDYLEPMFVVVIMVLASSSPIVKLAEDCLRLFAA-----CGGDS 192 Waddl...
CCB85693               129 IPLVASI-----TFL--YDWK------AAINFLN-TRNYTEALFISVIMTIASSHPIMNLAESFIRKVAS-----LGKES 189 Parac...
WP_014804891            62 ALLF--------LII--IGQNqs--vtPASKYID-SLNFTEAKFVLAIMVMAASKPVLRAAEQLINGLARl----LPLPS 124 Turne...
WP_014245076            59 AILIGYMsvtqgLMV--FGEDghtvvgGAIKYLE-GLNYTEPAFVFVIMCIAGTRPVILFAEKIILGISKv----LPLPG 131 Halob...
Q6MK29                  59 ALFMAIF-----ISL--EGWT------SAMDYQS-NLNFIEPFFIFAIMVVCSTRPVLAAGRKGILFISSliqkvFRTPA 124 Bdell...
OUHSC:BDW_09435         59 SLFMIVY-----ISL--EGWK------SAIEYQE-GLSFVEPFFIFAIMVVCSTRPILTVARQGILAISLfiqkiFKTPA 124 Bdell...
PRJNA63271:OPIT5_01950 220 VAAWWLAILIVAPLLGSFITEPAAMTIAALLLARQFYAHRPSPTLAYATIGLLFVNISVGGTLTHFAAPPVLMVAQPWKW 299 Opitu...
jgi:Amuc_1617          224 PGAWWISVMCLAPLLGSLITEPAAMTIGALILSKKFYDLKPKKTLMYATLGLLFVNISIGGTLTHFAAPPVVMVAEKWDW 303 Akker...
Q2IF09                 135 PFAWWLSTLTLGPLLGSLITEPAAMIICALLLGRRVLDLDPTRRLRYATLGLLFVNVSVGGTLTHFAAPPVLMVAARFGW 214 Anaer...
jgi:Caka_1379          221 PAAWWLSILVVAPLLGSFITEPAAMTIAALLLAQQFYKLEPGGTFKYATLGLLFVNVSVGGTLTHFAAPPVLMVAGTWHW 300 Coral...
WP_013182769           193 VKSWWWAILTIGPISGSLITEPGAMTISALLLSKQFYDLKPSPKFAYATLGLLFTNISVGGVFTHFAAPPVLMVTKSWHW 272 Waddl...
CCB85693               190 PGAWWVSLLTIGPILGAVITEAGAMIVTCLLLAKQFYTRPVSQKLAYATLGLLFTHISLGAIMTNFCTPVDWMHAEQLGE 269 Parac...
WP_014804891           125 GAAFYFVALGIGPVLGSFITEPAAMTLIALILRQRLYSRDVSKTFAYATLGLLLVNVSVGGVLTHFAAPPVLMVAGKWNW 204 Turne...
WP_014245076           132 KMAFYVSALVIGPLLGSFITEPAAMTVTALILLQYFYSNEMSHKFKYATLGLLFVNISIGGTLSHFAAPPVLMVAGKWHW 211 Halob...
Q6MK29                 125 VLTDIFVVLILGPLSGSFITEPAAMTVTAFMLNSML--QKESSKLIYGLIAVLFVNISIGGALTPFAAPPILMVAGKWNW 202 Bdell...
OUHSC:BDW_09435        125 VVTDLFVVMIIGPLSGSFITEPAAMTVTAFMLNSMI--SKDAKKIIYPLIAFLFVNVSIGGALTPFAAPPILMVASKWGW 202 Bdell...
PRJNA63271:OPIT5_01950 300 DTLFMLSHFGWKAAIGIAASSLLYYAIFRGEF--ARMNAAAklhrgNDAASPhrstrqaapIP-AWVTLVQIAFMAWTVF 376 Opitu...
jgi:Amuc_1617          304 GLAHMIQHFGWKAVSAIVISNLAYFLLFRREF--ARLASQQrefdeFDDAVPqswedrndkIP-LWVTLAHVCFLVWTVL 380 Akker...
Q2IF09                 215 DTPHMLANFGWKAAVAIALSNLLYAAIFRKDL--QALAARAeaeaaARDAGArpde-ptprSP-VWIVVVHLVLLALVVK 290 Anaer...
jgi:Caka_1379          301 NMPFMFTHFGWRAILGIIVATAVYFFVFRKQF--AELAEKAkameaSQESGPap-----epAP-AWIIIVHLLFVGWTVL 372 Coral...
WP_013182769           273 DTPYMAFHFGWKAIMGILICNLTYYLVFRHEF--KRLEENSklrhvWEEKEKkde----mkIP-FWISLVHLFFLAWTVV 345 Waddl...
CCB85693               270 EEILTLVMFSWKSLLAIFTSTICYYLYFRDEF--AELAKKEqhrvsEIKNS----------VP-WWVTATHAICLIGTIL 336 Parac...
WP_014804891           205 GLSYMFMHFGWRGLLTTITGTIIVMALFTREL--KKIAPAEerk---------------gtIP-VWLTLMHLALIGLTVV 266 Turne...
WP_014245076           212 GFMHMITHFGYKSTVAILISTAVVVAIFRKELagSLQVKEAqen---------------alVPtWWMTLTHLIFMGLVVY 276 Halob...
Q6MK29                 203 DFTFVMSNFGWKSAIAVVINTALLIAVFRKQLseGCITLREvetrlAGSQAA---------IP-VPVTLVHLLFLTGIVV 272 Bdell...
OUHSC:BDW_09435        203 DFSYVFTHLGWKSAVAVVINTVILLAFYRKQFseNCITLEEvekriTGSHAK---------IP-MGVTIVHLIFLVGVVV 272 Bdell...
PRJNA63271:OPIT5_01950 377 VAHYPALFVGGFLFFLAFMQATAHHQKPIELKSPLLVGFFLAGLVIHGGLQGWWIEPVLKSLGELPLFLGATILTAFNDN 456 Opitu...
jgi:Amuc_1617          381 FAHEPVMFIGSFLFFIGFTLATPQYQNQMSLRVPIMVGFFLAGLVILGGVQAWWLEPVLTRLGDYAM-VGATLLTAFNDN 459 Akker...
Q2IF09                 291 AAHTPPLFVGLFLFFMAFHAATAPHQQPLDLRAPILVGFFLAGLVVHGALQQWWIAPVLGRLDPLSLLFGAAGLTAFNDN 370 Anaer...
jgi:Caka_1379          373 TLHHPAFFIGGFLFFIAFTMATHHHQYEIKLKSPLLVGFFLAGLVTHGGLQGWWISPVLSALTEVPLFIGATVLTAFNDN 452 Coral...
WP_013182769           346 HNHYPSIFIGTFLLFLGFSQATSSYQRRLDLKPAILVGFFLAGLVVHGNLQGWWIAPVLSNASEGMLLLVSAFLTSFNDN 425 Waddl...
CCB85693               337 CLYHPTIFICITCLFLVFHEITHPYQTRLKLRPPMLVGFFFSGLVIHGGLQEWWITPLLERVDALMLTGASYMFGSFIDG 416 Parac...
WP_014804891           267 FAHHENIFFGIFMIFLGLTVATKEYQEPLKLREGLLVGFFLAGLVTLGSLQAFWLKPLLESLDVNQLYFGATGLTAITDN 346 Turne...
WP_014245076           277 TAHHMVFFLGLFLFFLGFATITQQYQDAIKLKESLLVGFFLAGLVTLGAQQAWWLQPVLGKMNDIVLFFGATALTAITDN 356 Halob...
Q6MK29                 273 TAHYQNAFMGIFLLFLGVAAVTQRYQDSLRLKESLLVAMFLGGIIQFGAFQKWWLAPLLGSMSDLLLFKGAVGLTAITDN 352 Bdell...
OUHSC:BDW_09435        273 TGHYQNAFLGLFLLFLGVATVTQRYQDTLRLKESLLVALFLGGIIQFGAFQKWWLTPLISSMSDLALFKAAAGLTAITDN 352 Bdell...
PRJNA63271:OPIT5_01950 457 AAITYLATLVPGFT--------------------DAFKYAVVAGAVTGGGLTVIANAPNPAGQSILQ--RFFPE-GISPL 513 Opitu...
jgi:Amuc_1617          460 AAVTFLASTVPNLP--------------------EAVKYSVVAGAVTGGGLTVIANAPNPAGQAILG--KYFK--GINPL 515 Akker...
Q2IF09                 371 AAITYLASLVPTFD--------------------AAARYAVVAGAVAGGGLTVIANAPNPAGQAALA--RYFPD-GVKPA 427 Anaer...
jgi:Caka_1379          453 AAITFLAAQVPAFSpdtmvagqwvsktgaalanaQGLEYAVVAGAVTGGGLTVIANAPNPAGQSILS--KFFGD-GVSPM 529 Coral...
WP_013182769           426 AEITFLATLIPSFT--------------------DGMKYAVVAGAVTGGGLTVIANAPNPSGQAILG--KYFDN-GISAV 482 Waddl...
CCB85693               417 ATLTYLATLLPSLN--------------------DATKYSVIVGTLAAGGLTVIGHPLNSEKDTPQN--SHFSE-GISPK 473 Parac...
WP_014804891           347 AALTYLGSLSPGLS--------------------EQMKIALVAGAVTGGGLTVIANAPNPAGVGILRhsKFFQEnGLSPL 406 Turne...
WP_014245076           357 AALTYLGSLVE-LT--------------------DSAKYNLVAGAVAGGGLTVIANAPNPAGFGILK--GSFGKeGISPL 413 Halob...
Q6MK29                 353 AALTYLGSQVEGLS--------------------DSSKYALVAGAIAGGGLTIIANAPNAAGYSILS--HKFPG-GIKPL 409 Bdell...
OUHSC:BDW_09435        353 AALTYLGSQVEGLS--------------------EGSRYALVAGAIAGGGLTIIANAPNAAGYSILS--RKFDG-GIKPL 409 Bdell...
PRJNA63271:OPIT5_01950 514 GLLAGALPPTVIMALCFLLL 533 Opitutaceae bacterium TAV5
jgi:Amuc_1617          516 WLFAWAAFPTAIVFIFF--T 533 Akkermansia muciniphila ATCC BAA-835
Q2IF09                 428 SLAAAALAPTAIVLACF-LW 446 Anaeromyxobacter dehalogenans 2CP-C
jgi:Caka_1379          530 KLVLGALFPTLVMAVMFMVL 549 Coraliomargarita akajimensis DSM 45221
WP_013182769           483 SLFSAAIYPAVIMGVCFYLF 502 Waddlia chondrophila
CCB85693               474 KLFCAALFPMFVTASIFFIF 493 Parachlamydia acanthamoebae UV-7
WP_014804891           407 FLLLGATGPTLVAILFFWVL 426 Turneriella parva
WP_014245076           414 GLLLGAIGPTLIAMLCLELL 433 Halobacteriovorax marinus
Q6MK29                 410 NLLVAALVPTTVAVVCLWLL 429 Bdellovibrio bacteriovorus
OUHSC:BDW_09435        410 NLLLAALVPTAVALACLWLL 429 Bdellovibrio bacteriovorus W
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap