Conserved Protein Domain Family
DUF1501

?
pfam07394: DUF1501 
Protein of unknown function (DUF1501)
This family contains a number of hypothetical bacterial proteins of unknown function approximately 400 residues long.
Statistics
?
PSSM-Id: 399989
View PSSM: pfam07394
Aligned: 49 rows
Threshold Bit Score: 171.342
Threshold Setting Gi: 81621082
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9A5N3  44 YKAIVCLFLVGGNDANNLLVATDDASWQRYWSarfrgatpialmppgtaptpigsvnavskrtvsatnfpeYWGGVLPIT 123 Caulobacter vibrioides
Q7MCK0  38 YKAIVVISLGGGNDGFNTIVATEQYDL--------------------------------------------YYQARQKLA 73  Vibrio vulnificus YJ016
Q7MLK9  33 YKALVCVFLFGGNDGFNMLVPTSDAHYDEYARa------------------------------------------rPDIA 70  Vibrio vulnificus YJ016
Q87HJ3  35 FRALICVYLAGGNDAINTILPLSDFHYNQYANv------------------------------------------rGSLS 72  Vibrio parahaemolyticus
Q7MDY0  67 FKALVCIYLAGGNDAINTVLAKDNEHYLQYKNv------------------------------------------rGNLA 104 Vibrio vulnificus YJ016
Q7NT93  33 KRLLVLVELKGGNDGLNTVVPYASADYYRLRPg----------------------------------------------- 65  Chromobacterium viola...
Q8P3X8  29 SARMLVVFLRGGYDSNNLLVPHGSDFYYQARPt---------------------------------------------lA 63  Xanthomonas campestri...
Q7VYL6  29 DTRLLVVFMRGAYDAASLLVPTTSEFYYESRPh----------------------------------------------- 61  Bordetella pertussis
Q9A6V4  38 RKKLVIVICRGGMDGLSVSPPVGDANYAALRGs----------------------------------------------- 70  Caulobacter vibrioides
Q7UPP6  56 AKHIIYLFMDGAMSHLDTFDPKEGVEEAGET----------------------------------------KPISTRVPG 95  Pirellula sp.
Q9A5N3 124 PKTPQRAAGAapGAPART----FGLHPLM-PNMQKafnAGRLAALANVGTL---------VAPLTKAQYQKPTagVQIPP 189 Caulobacter vibrioides
Q7MCK0  74 IPLNDLLPIN--TQGENT----LALHPAL-DALVPlidEGYGLPIMANGQC-------------------RGLdgDTLPI 127 Vibrio vulnificus YJ016
Q7MLK9  71 LAKESLLPLTlaTGSTLS----LGLHPAM-SELQGlvnRGKAIPIVNSGVL---------VEPTTKAELVNGT--RALPP 134 Vibrio vulnificus YJ016
Q87HJ3  73 VAKNTIIPIRlnAHDANNnavpLGLHPKL-SALAPlfqQGDANLVLNSGIL---------NQPVTKQAIEQGD--VPLPE 140 Vibrio parahaemolyticus
Q7MDY0 105 LSQSQIIPLSlkAQDNQGkpvtLGLHPAM-SKLANvfnQGDANVVLNSGIL---------CQPTTKQQILDGT--AMLPE 172 Vibrio vulnificus YJ016
Q7NT93  66 ----iAIAREqvLQINGD----IGLHPSL-APLMPlwqDKQLALLQGV----------------------------GYPD 108 Chromobacterium viola...
Q8P3X8  64 IARPDTNNPRsaLALDAQ----WGLNPVVgESLLPlwqRKQLAFVPFA----------------------------GTDD 111 Xanthomonas campestri...
Q7VYL6  62 ----iAIARDaaAALSDG----WALHPAVkDSLLPfyqRGELAFVPFA----------------------------GTDD 105 Bordetella pertussis
Q9A6V4  71 ----iALQRDqvRMLDDT----FGLHPDL-KAVHAltqKGQARIAPAI----------------------------ASPD 113 Caulobacter vibrioides
Q7UPP6  96 IQFGDRFPKL--SYLAGA----IATVRSLsTETGA---HEQGRYLMRTAYKqinsiqhpgMGAWMVDRQGRAN--KELPG 164 Pirellula sp.
Q9A5N3 190 RLFSHNdqqqtwQTGQvGYGAL----GYGGQMGDLFAAsSSGAASinftafttagltgfPVGAQVKAYRISVGPTGGSAV 265 Caulobacter vibrioides
Q7MCK0 128 IPSGSGnhsnmlLGMHtGFVNGeipgGWAGRAVEHITKgALSTPHp-------------LFSSNQTLRVTQSENYRQEVI 194 Vibrio vulnificus YJ016
Q7MLK9 135 FLFSHNsqqaewQRGWaGSSSTl---GWAGRMMDVLSNgQLDVSP--------------TFSINGYVQWLNGEKQRANLI 197 Vibrio vulnificus YJ016
Q87HJ3 141 QLFSHNsqtaswLRGGmDASTNl---GWAGRMLDVLTS-DAQITP--------------LYSVHGDTLWLKAMEHRQTVL 202 Vibrio parahaemolyticus
Q7MDY0 173 QLFSHNsqsdewMRGAaNSGINl---GWAGRLLDALSC-QSSVTP--------------LYSVHGDSLWLRASEYQQVVL 234 Vibrio vulnificus YJ016
Q7NT93 109 PNLSHFrsieiwDTASaSQQYLs--eGWLTRLFHEQPTpKNFAAD--------------GVVLSSQVLGPLDGGARAVVL 172 Chromobacterium viola...
Q8P3X8 112 LSRSHFetqddiESGQvATQRRdyrsGFMARLSGVLSGvP-------------------AIAFTDSLPLTFQGAGDLPNV 172 Xanthomonas campestri...
Q7VYL6 106 ASRSHFetqnriELGRaGGSGAapasGFLNRLAAQLDGkAGR-----------------PAAFTEDVPQIFRGQARVPNI 168 Bordetella pertussis
Q9A6V4 114 RARSHFeaqdvlETGSaKVYGAe--tGWLNRTLEALAPvRPIE----------------GLSVGTTAPLILRGKVQAASW 175 Caulobacter vibrioides
Q7UPP6 165 NFLIG-------------SGNRhpgaGFLPPALSPVPI-ANANSG--------------LQNIKLPKYLDEKLFYRRLAL 216 Pirellula sp.
Q9A5N3 266 RVDLLQKTGSYNNSPTFLSALSATLLGNDaegsVLGQAYADAMVTSNNTAAAFSTALASspVSaPPAftnpltgatqtns 345 Caulobacter vibrioides
Q7MCK0 195 TPNGIASGFLSAWSEGPRLRAMQYDVANPrenlFMRHNQ---NMLAEFTAPKEEFIPIFeqPVlDGFpnttlg------- 264 Vibrio vulnificus YJ016
Q7MLK9 198 NPDGMPT--LWANNNTLRRQSFDQVLALQpdslFAQAFD---QVKSDSITIRDQLSAALesSPeEPHfpdnrl------- 265 Vibrio vulnificus YJ016
Q87HJ3 203 KKDKAVQ--LTAVGNPLYEEVYQKLLSQSadnpFSGHFN---LMVDESMMMSNILAEQLklIDdAPLfssstl------- 270 Vibrio parahaemolyticus
Q7MDY0 235 RKDRAVE--LNGLADSGLSDLYDEMLAFEsespFQRQFR---RMVNHSRAVSHTLSQTLdsVPdNPMftssdl------- 302 Vibrio vulnificus YJ016
Q7NT93 173 ---------SNPQDFARQAKLVADQQPGRagaaLEHILKVEGDIRQAAASLAPLPRTAAseAPtAGPkpng--------- 234 Chromobacterium viola...
Q8P3X8 173 SLKG-----IGKRGLDDRQAQILAQMYGAt--pLAAAARDGLALRQQVTTQLREEMEQAgrGAaSARtf----------- 234 Xanthomonas campestri...
Q7VYL6 169 DLGGA----KRKSRLTADSSSAIAQMYQGt--gLDASVNEGLAAMGQARAALEAEMREAngGAgNTEkl----------- 231 Bordetella pertussis
Q9A6V4 176 S--------PGKGVDETARLPMLLQDLYRsdplLGPAFARGLETEAMAEAAMAGQARAAmaPAmAAGgqnrgg------- 240 Caulobacter vibrioides
Q7UPP6 217 ANRFDKSFQSQRDNNDVEAYNQLYLETRKl---MGSEHLKVFDLNEEDAKIRDAYGRNS--------------------- 272 Pirellula sp.
Q9A5N3 346 ladqlrAVAQTIVAHGTLGPKRQVFFVQIGSFDTHDGQNDRQSLLL---AQVDHALAYFDAEMTAKGYGEAVTTFTASDF 422 Caulobacter vibrioides
Q7MCK0 265 -gklerIARVIMHQQASVGHDRQVFACEQGGYDTHSGQLSSQAKRL---KELGDAIAAFQNAMINAGKADEVALITISDF 340 Vibrio vulnificus YJ016
Q7MLK9 266 -sqqlhTVARLIKSSERLGHQRQVYFVGMGGYDTHANQLVAHQTLL---AELSQSLDAFNTSLDNAGIAHQVTTMTMSDF 341 Vibrio vulnificus YJ016
Q87HJ3 271 -gkqmqTVYKLIASQSALSQQRQVFFVKHTGYDLHDSQLARHPLLL---EDLATNLNAMYRAVDKLGMSKNVTTFTMSDF 346 Vibrio parahaemolyticus
Q7MDY0 303 -gkqlnTVFKLISQHQALGQSRQIYFVKQTGYDVHDTQLTQHPALL---EDLSDNMYALHQALGEYQLGDSVTTFTMSDF 378 Vibrio vulnificus YJ016
Q7NT93 235 ---gfgVAVRTLTDTLARGVDIAVARITLTGFDTHGNQQPVQARLL---AELADGLAQLKSEMTRLGRWNDTLALTYAEF 308 Chromobacterium viola...
Q8P3X8 235 -----aDETRRMATLMRDRYRLGFVDVG--GWDTHANQGSVEGGLAnnlRNLGQGLAAYADALGP--AWQDTVVVVISEF 305 Xanthomonas campestri...
Q7VYL6 232 -----eQEARRIGTFMAERYNLGFVDVG--GWDTHVGQGAANGVLAtklGQLGRALAAYAQAMGP--AWRHTTVVVISEF 302 Bordetella pertussis
Q9A6V4 241 -vetarKLGSTLGGFMTQAGGPQIAAVSLDGFDTHA---NQPGQIAtrlVNMDAVLDGLHTGLGA--EWKNTVVLVVTEF 314 Caulobacter vibrioides
Q7UPP6 273 ------FGQGCLLARRLVESGARFVEVNFGGWDMHQDLYSRLDEKA---TQVDDGMGFLLRDLHSKGLLDETLVVLTTEF 343 Pirellula sp.
Q9A5N3 423 SRTFTTNGD-GTDH-AWGAHHLILGGAVKGGDIYGQFPTVGVDDAATGFNNPDMSGTALIPTTSVDQ--YMATLAKWFGV 498 Caulobacter vibrioides
Q7MCK0 341 GRKFYSNGD-GSGH-GWATNSFVFSGAVKANIQVGTLD----------------YSKGDKATTPSEQ--VMATLVHWFGV 400 Vibrio vulnificus YJ016
Q7MLK9 342 GRRLASNGS-GTDH-GWASNHWVMGGALQSGRIYGQWPSLILDGEN------DFNRGRMIPTTSVEQ--IGATVAKWMGI 411 Vibrio vulnificus YJ016
Q87HJ3 347 GRRMTNNGN-GTDH-GWGGHQLLIGGAVNGSAPIGTWPELTLGGQD------DYSKGRLIPAIAADQ--VGSTLAQWMGV 416 Vibrio parahaemolyticus
Q7MDY0 379 GRRMASNGN-GTDH-GWGGHQIIMGKGVLSENAIGHWPTLKIDGED------DYSKGRLIPRIAADQ--VHGTLAKWMGV 448 Vibrio vulnificus YJ016
Q7NT93 309 GRRPRENGNrGTDH-GTANVHFALGGRVNGG-LYGQMPQLAGV------------SEGNLPHAIDFRqvYATAIDGWWGK 374 Chromobacterium viola...
Q8P3X8 306 GRTFRENGSkGTDH-GHGTAYWVLGGAVQGGRIAGEQVAVAQA---------QLLQNRDYPVLNNYRdlFGGLLGRLWGL 375 Xanthomonas campestri...
Q7VYL6 303 GRTLRENGNkGTDH-GHGSVYWVLGGGVRGGRIAGEQVAVKRD---------TLFQDRDYPVLTDYRalFAGLFGRLYGL 372 Bordetella pertussis
Q9A6V4 315 GRTARVNGTgGTDH-GTASTGLILGGALKPGGIVGDWPGLADK---------ALFENRDVAPTLDMRalFKGVLADHMGV 384 Caulobacter vibrioides
Q7UPP6 344 GRKPKLNANaGRDHhPGVFCSLLAGAGIKGGQVLGASDKHGGYVDEYPVSVSSFNKTIAAAAGLPLDeeFFAPNGRPFKI 423 Pirellula sp.
Q9A5N3 499 --PSDN-LAKI 506 Caulobacter vibrioides
Q7MCK0 401 ---PENeLELI 408 Vibrio vulnificus YJ016
Q7MLK9 412 --QTEQqLLDV 420 Vibrio vulnificus YJ016
Q87HJ3 417 --SDNAaLEYV 425 Vibrio parahaemolyticus
Q7MDY0 449 --HDDQlMRYV 457 Vibrio vulnificus YJ016
Q7NT93 375 --DSHNvLGGR 383 Chromobacterium violaceum
Q8P3X8 376 --SPSQlERVF 384 Xanthomonas campestris pv. campestris
Q7VYL6 373 --DAQRlQAVF 381 Bordetella pertussis
Q9A6V4 385 --DRALlDKTV 393 Caulobacter vibrioides
Q7UPP6 424 ggDDDPiPELL 434 Pirellula sp.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap