5YFP


Conserved Protein Domain Family
Sec10

?
pfam07393: Sec10 
Click on image for an interactive view with Cn3D
Exocyst complex component Sec10
This family contains the Sec10 component (approximately 650 residues long) of the eukaryotic exocyst complex, which specifically affects the synthesis and delivery of secretory and basolateral plasma membrane proteins.
Statistics
?
PSSM-Id: 399988
View PSSM: pfam07393
Aligned: 26 rows
Threshold Bit Score: 457.965
Threshold Setting Gi: 121896819
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YFP_E    120 LHTTLLTFDKLDDRLTN-----------VTQVVSPLGDKLETAIKKKQNYIQSVELIRRYNDFYSMGKsdIVEQL-RLSK 187  Saccharomyces cer...
X5JA13    139 VDGLFESFARLDGRISS-----------VGQTAAKIGDHLQSADAQRETASQTIDLIKYLMEFNGSPG--DLMELsALFS 205  thale cress
Q2QV94    117 VDGLFDSFARLDSRISS-----------VGQTAAKIGDHLQSAESQRETASQTIDLIKYLMEFNSTPG--DLMELsPLFS 183  Japanese rice
EAW23549  126 LNTLSDGFDQIKLTTSVpseevhelekdPVLGALKQVRSVRGEARVEYGKVHAA-LAPFYDDIVTSGPs-PDNLLfKEYP 203  Aspergillus fisch...
Q5BGH2    123 VTPISDGFDQINLSASAandvv-dldtdPVLGALKLARSIRGEARQEYGKIHAA-LAPFYDDIATLGPs-PENLLfQRYT 199  Aspergillus nidulans
Q2URB8    132 LKTLSDGFDQITLSTPAttgksneleddSVLGALQQVRSVRGEARNEYGKVHAA-LAPFYNDITTEGAs-PDNLLfKKYT 209  Aspergillus oryzae
Q4RLZ1     80 NQVAFQHFQELDEHISY-----------VATKVCHLGDQLEGVNTPRQRAVEAQRLMTYFNEFLDGD------LRsDVFN 142  spotted green puf...
Q18406     46 NGEAIDKMKQLDHTMQA-----------VSTKVVHLGDQLESVDQPRSRAHDAHQLMQHFDEFLSDQP-----LNsMIFT 109  Caenorhabditis el...
Q7PQN8     88 HQVSVDYFHQLDEKINS-----------VAGKVIHLGEQLQNVNMPRSRAVEAQLLLNHMAEFLTPGP-----IVnDIYS 151  Anopheles gambiae...
Q9XTM1     89 HQTAIDVFGQLDEKINS-----------VAGKIMHLGEQLENVNTPRSRSVEAQKLLNFMSEFLAAGP----VIVnDIFA 153  fruit fly
5YFP_E    188 NWKLNLKSVKLMKNLLILSSKLEt-----------sSIPKTINTKLVIEKYSEMMENELLENFNSAYRENN-FTKLNEIA 255  Saccharomyces cer...
X5JA13    206 DDSRVAEAASIAQKLRSFAEEDIgrqgasaaagnatPGRGLEVAVANLQDYCNELENRLLSRFDAASQRRD-LSTMSECA 284  thale cress
Q2QV94    184 DDSRVAEAASIAQKLRSFAEEDVgrhgvpsavgsanASRGLEVAVANLQEYCNELENRLLARFDTASQRRE-MSTMAECA 262  Japanese rice
EAW23549  204 DP---EHQAQILSQLRLFAQCD--------------TTEGWRERNARLQSAISMFETAAMKEFRQGYESEDiDGTMRKYA 266  Aspergillus fisch...
Q5BGH2    200 EP---QQQAQILSQLQAFARCD--------------TTTGCENRHENLRAAVSMFETAALKEFRHGYETDDiDGRMKNYA 262  Aspergillus nidulans
Q2URB8    210 DP---QHQARILFQLQSFAKCD--------------LTEGWHERLSHLQEAISMFETAAIKEFRHGYETEDiDNRMRQYA 272  Aspergillus oryzae
Q4RLZ1    143 NPDKIKEAADIIQKLHLIAQEL--------------PFDRFPDVKAKIASKYHDLERQLIQEFTAAQRRGE-IGRMREVA 207  spotted green puf...
Q18406    110 DPDKLLESADLVHKLYSISQEL--------------NKDKFANVQARIGQRYKVVEDLLIEEFVRSQRDEK---KMAEVA 172  Caenorhabditis el...
Q7PQN8    152 DKSKLYEAADIIQKLFQISQDL--------------PAQRFANAKKKIESKYDDVEMQLIEEFATAQKMEN-IERMKELS 216  Anopheles gambiae...
Q9XTM1    154 DAARLSEAADVIQKLYAISQDL--------------PPGNFAESKRKIEKKYDEVERRLIEEFATAQKSED-IERMKTLA 218  fruit fly
5YFP_E    256 IILNNFNGGVNVIQSFINQHDYFIdtkqidlenefeNVFIKnVKFKEQLID--FENHSVIIETSMQNLINDVETVIKNES 333  Saccharomyces cer...
X5JA13    285 KILSQFNRGTSAMQHYVATRPMFI------------DVEVMnSDIRLVLGDhgSQPSPSNVARGLSALFKEITDTVRKEA 352  thale cress
Q2QV94    263 KILSQFNRGTSAMQHYVATRPMFI------------DVDIMsIDIQVVLGEegPQADHICIAEGLSVLYKEIADTVRREA 330  Japanese rice
EAW23549  267 HVLFTLNGGDSAIEFFINHNHLITqksdlg-rvadcIDG--------------LNQ--RVKLEHTQAFFTRLSVAYNEEV 329  Aspergillus fisch...
Q5BGH2    263 HVLYTLNGGGSASELFTHHNHIITrkaelg-qtndcIDT--------------LTQ--KVKLHQTQAFFTRLSVAFNEEV 325  Aspergillus nidulans
Q2URB8    273 HVLYTLNGGAAAVELFIHHNHLVTrrsdyg-kpgdcIDA--------------SSQ--SVKLDQTQAFFTRLSVAYNEEV 335  Aspergillus oryzae
Q4RLZ1    208 AVLLHFKGYAHCVDVYIKQCQEGA--------------------------------------YLRNDVFEDTAILCQRVN 249  spotted green puf...
Q18406    173 KILSEFKGYSGCVDRYVD-----------------------------------FLCQSIHPRGDGGEILADCLQLCRTQQ 217  Caenorhabditis el...
Q7PQN8    217 DILSQFKGYTQVIDVYIEQSQATT--------------------------------------YGGRDVFEGIVPLCHKHY 258  Anopheles gambiae...
Q9XTM1    219 QILSQFKGYTQCVDAYIEQSQMQP--------------------------------------YSGKDIFIGIVPLCKHHY 260  fruit fly
5YFP_E    334 KIVKRVFeEKATHVIQLFIQRVFAQKIEPRFEVLLRNSLSI--------SNLAYVRILHGLFTLFGKFTKSLIDYfqlle 405  Saccharomyces cer...
X5JA13    353 ATITAVF-PTPNEVMAILVQRVLEQRVTGILDKILAKPSLMspppvqegGLLLYLRMLAVAYERTQELAKDLRAV----- 426  thale cress
Q2QV94    331 TTIMAVF-PSPNEVMSILVQRVLEQRVTAILDKLLIKPSLAnlppieegGLLHYLRVLAVAYDKTKELAKELQSI----- 404  Japanese rice
EAW23549  330 SIINRAF-PPSMNVGPTFVEKVAQDVLYPFLTAIFDELHRS--------NLESYLIAVSGTFAQSLNLSEALLPIqnt-- 398  Aspergillus fisch...
Q5BGH2    326 SIINRAF-PPALQLAQPFVEKVGRDVLYPFLTAIFDELHRS--------NKEEYLVSVSSTFAQCMNLCDNLLPIqns-- 394  Aspergillus nidulans
Q2URB8    336 AIINRAF-PPSLKVALPFIAKVGQDVLYPFLTAIFDELHRI--------NKESYLTAVSSTFAQCMNLSDTLLPIqss-- 404  Aspergillus oryzae
Q4RLZ1    250 KQVGEVF-SSPETVMAKLIQNIFENKLQSHVKDRLDGTRHS--------DVEQYLKNLYDLYTRTTALATKLTEFnlg-- 318  spotted green puf...
Q18406    218 PRISAIF-PSPHTVMQKLVLNIFTGRMKETITARLRECKDTd-------DQEHYLRDLAYLYSSTLKMCKELEKLhi--- 286  Caenorhabditis el...
Q7PQN8    259 KIIQQVF-NAPDKVISKFILNIYQLKINQFVQTKLDDRK----------DENKYLKTLSELYSRTMKLSAELQEFfk--- 324  Anopheles gambiae...
Q9XTM1    261 EIIQKVF-ANPQQVMSKFILNIYQLKLHQYAMTKLEDKK----------DEEKYLRTLYELYSRTLKLSTDLQIYms--- 326  fruit fly
5YFP_E    406 iddsnqiLSTTLEQC--FADLFSHYLydrSKYFGIEKRSLEAILVDMTSKFTvnydkeinkrvlldkykek--------l 475  Saccharomyces cer...
X5JA13    427 -------GCGDLDVEdlTESLFSSHK---DEYPEHERASLKQLYQAKMEELR---------------------------- 468  thale cress
Q2QV94    405 -------SCGDLDIEglTESIFVSHK---DEYTEFEQASLRQQYQSKMAELR---------------------------- 446  Japanese rice
EAW23549  399 ----tdtLDEFLHHI--VAKVYEPHI---DLYLAEELDHFRKNSAAVVDEWDrqlseqaastesflmsnvnrqadkrdfl 469  Aspergillus fisch...
Q5BGH2    395 ----ldtFEDLLHQT--IAQVYEPHM---DLYLAEELDFFRKGSEASVAEWDrqlseqaastesfllsnvnrqadkrdfl 465  Aspergillus nidulans
Q2URB8    405 ----avnFEEFLEHV--IAKVYEPHM---DLYLAEELDHFRKCSEAAVDEWDrqlseqaastesflmsninrqadkkdfl 475  Aspergillus oryzae
Q4RLZ1    319 -----sdKHTFLSKL--IKSIFSTYL---ESYIDMEKEYLRNRGAMILQRYY---------------------------- 360  spotted green puf...
Q18406    287 -----spDSAFLSTL--TDSIFQRYI---ATYCSEELKYLNDQCSNLLQRFY---------------------------- 328  Caenorhabditis el...
Q7PQN8    325 -----gsEDDLLQKL--TANIFDRHL---ATYIEVESRTLDAKCQVELKKFY---------------------------- 366  Anopheles gambiae...
Q9XTM1    327 -----tiDDDLLQKL--TQQIFIKHL---AGYAEMETKCLTAKCSTELEKFY---------------------------- 368  fruit fly
5YFP_E    476 stnvdafmhsprgnthsRQDSTSRSKLSQFNSFLKTHLDKDHLSlnrtntlsdsfnnsssstqydvannssslvnssfta 555  Saccharomyces cer...
X5JA13    469 -----------------AESQQVSESSGTIGRSKGASISSSLQQ------------------------------------ 495  thale cress
Q2QV94    447 -----------------AEAKQQSESTGTIGRSNGAAVTTSLQQq----------------------------------- 474  Japanese rice
EAW23549  470 tsfkkvimapvnilpsfSSSKSSETKSDQESIGSEPSS--ALKSpnrfstiaspaltptveappt-------telaakaa 540  Aspergillus fisch...
Q5BGH2    466 tsfkkvimapvnilpsfSNKSSEQQKPDRDSLAGD-SG--STPRanrfstisspgtppiqeapt--------telaakaa 534  Aspergillus nidulans
Q2URB8    476 tsfkkvimapvnllpsfSGTKTNESKSDEETSAGDAS---ALKGqnrfstismpttpvteaptt---------elaakaa 543  Aspergillus oryzae
Q4RLZ1    361 -----------------DSKNHQKRSIGT--GSIQELKERIRQRtnlslgpv---------------------------- 393  spotted green puf...
Q18406    329 --------------------ESKKHVKKQIGGGLHELKRDVAARlmnvet------------------------------ 358  Caenorhabditis el...
Q7PQN8    367 -----------------ETKNHQKKQIERFQELRRDMQALIGSRaniniaqi---------------------------- 401  Anopheles gambiae...
Q9XTM1    369 -----------------ASKKHQKTATTK--GFRRNMEVLIATRaniniaai---------------------------- 401  fruit fly
5YFP_E    556 sdidnspnspanYSLNDVDSMLKCVVESTARVMELI------PNKAHLYILEILKIMFLGIvDSYMEIALE-VAY----- 623  Saccharomyces cer...
X5JA13    496 ------------ISVTVVTDFVRWNEEAITRCTLFSs----qPATLAANVKAIFTCLLDQV-SVYITEGLErARDslsea 558  thale cress
Q2QV94    475 ------------ISVTVVTEFVRWNEEAISRCTLLFs----qPATVAANVRSIFACLLDQV-SQYLTEGLDhAREslnha 537  Japanese rice
EAW23549  541 vmksklegirslFSIEIALSLVHSAKSSLDRAAQFVkiggetGAAAKQQCEAIFVSLLRILgHQHLIVGFNkAVDhl--- 617  Aspergillus fisch...
Q5BGH2    535 imksklegirslFSIEVALGLVHAAKSSLERAARFMaiggetGAAVKQQCEAIFVALLRILgHGHLIKGFDkAVDhl--- 611  Aspergillus nidulans
Q2URB8    544 imkskmegirslFSIEVALSLVHAAKSGLERAAQFVqiggdtGALAKQQCEAIFVALVRILgHRHLIVGFNkAVDhl--- 620  Aspergillus oryzae
Q4RLZ1    394 ----idthgetfLSPELVVNLLQETRHAFERCHRLSd-----PSDLPKNAFSIFLLLVEHLcVEHIDYALE--------- 455  spotted green puf...
Q18406    359 ------yggetfVAEDVAISILQETKNAFGRANQLCd-----KEELPRHVENIVDVLLKYLyGEHLDYAVE--------- 418  Caenorhabditis el...
Q7PQN8    402 ----edyggetfLSEELAINLLQQSSHAFERCCLLSk-----ETDLPRNILKLTDTLLRYLlHEHCDYALD--------- 463  Anopheles gambiae...
Q9XTM1    402 ----edyggetfLSEELAINMLQEAKASLKRCRLLSn-----ETELPGNAIKLNDILLRFLmHEHVDYALE--------- 463  fruit fly
5YFP_E    624 -------------------WKICKVDinKTAGVVNLN-FLKFISMSTEILDLLSISIKSIFL-PLLnNSPEIKAQIIEMT 682  Saccharomyces cer...
X5JA13    559 aalre----rfvlgrrvaaAAASAAEaaAAAGESSFKsFMVAVQRCGSSVAIVQQYFANSIS-RLLlPVDGAHAASCEEM 633  thale cress
Q2QV94    538 atqrdryvigtsvsrrvatAAANAAEaaAAAGESSFRsFMIAVQRCASSVAILQQYFSNTIS-RLLlPVDGAHPSACEDM 616  Japanese rice
EAW23549  618 -----------------snYRPREQGerDQAGVEPLVtFLELVNVGDLILQMMDVFYEQELVgAKItDRNDFLDPAVKEK 680  Aspergillus fisch...
Q5BGH2    612 -----------------sdYRPREQGdrDQSGVEPLVtFLELVNVGDLILQMIDVFYEQEMIgSNItDRNDFLDPAVKEK 674  Aspergillus nidulans
Q2URB8    621 -----------------snYRPREQGerDQSGVEPLVtFLELVNVGDLILQMIDVFYEQELIgKKLtDRNDFVDPAVKEK 683  Aspergillus oryzae
Q4RLZ1    456 -------------------IGLSAIPssDAKN-ANLY-FLDVVQQANSIFHLFDKQFHDQLM-PLIsSSPKLA-ECLHKK 512  spotted green puf...
Q18406    419 -------------------TGLAGISlaESKTEPPAY-FFSVVAKCTSVILLMIKQFEDPIF-PIIkETIVEP-SVAKKW 476  Caenorhabditis el...
Q7PQN8    464 -------------------LGLQAIPiaECKSVPQIY-FFDVAQKCNAIVHLLEKTYNASVI-PNViGTPQYT-DCIQKK 521  Anopheles gambiae...
Q9XTM1    464 -------------------LGLQAVPlaEGRVFPQLY-FFDVVQKTNIIVHLLDKLCHTSVI-PCVsNTPKYS-DYVFKK 521  fruit fly
5YFP_E    683 NSQIQKMEILINIILQETITVISTKFSAILC-KQKKKDFVPksq----ellD--QDTLPAIEIVNILNLIFEQSSKFLKG 755  Saccharomyces cer...
X5JA13    634 STALSKAEAAAYKGLQQCIETVMAEVDRLLSsEQKSTDYRStdd----giaSdhRPTNACIRVVAYLSRVLESAFTALEG 709  thale cress
Q2QV94    617 GSAVSVVEAAAHKGLLQCIDTVMSEVERLLSsEQKATDYRTpdd----gaaPdhRPTNACIRIVAYLSRVLEVAFSALEG 692  Japanese rice
EAW23549  681 KKFEQILDERVAAGLNKGIDVLMEEVDYILAtRQQATDFNPdvstdpyrktMdvAVSEAAAAVVDVVSSHTQMLVGSTDK 760  Aspergillus fisch...
Q5BGH2    675 KKFEQNLDERVAAGLNKGIDVLMEEVDYILAtRQLATDFNPdvstdphrktMdvSVTEAAAAVVDVVSSHTQMLVGSTDK 754  Aspergillus nidulans
Q2URB8    684 KKFEQNLDERVAAGLNKGIDVLMEEVDYILAtRQLATDFNPsvstdpyrqtMdvSVSEAAVAVVDVVSSHTQMLVGGTDK 763  Aspergillus oryzae
Q4RLZ1    513 KEVIEQMEVKLDTGIDRTINCMVGQMKYILAtEQKKTDFKPede----nnvMi-QYTTACSKVCVYVSRQVEHVRKSMDG 587  spotted green puf...
Q18406    477 QQSLRSLESKMSLGLERQLNSIVGYVKFLFS-EQKKTDFRPdsq----qidI--RVSPQCQLASRFLANQVAAMELGCDG 549  Caenorhabditis el...
Q7PQN8    522 RSYLETVENKIETGLERTLNAIFGWVKTYLSsEQKKSDFKPdtd----vdtV---ASNACLAVVQYLNPLIGLIQKTIDG 594  Anopheles gambiae...
Q9XTM1    522 RILMEQIETKLDQGLDRSISAVIGWVKVYLQyEQKKTDYKPetd----vdtI---SSAACLQVVQNLQPVIVQIKKCVDG 594  fruit fly
5YFP_E    756 KNLQTFLTLIGEELYGLLLSHYSHFQVNSIGGVVVTKDIIGYQTAIEDWGVASLIDKFATLRELANLFTVQPELLESLTK 835  Saccharomyces cer...
X5JA13    710 LNKQAFLTELGNRLEKLLLTHWQKFTFNPSGGLRLKRDLNEYVGFVKSFGAPSVDEKFELLGIIANVFIVAPDSLPTLFE 789  thale cress
Q2QV94    693 LNKQSFLTELGNRLHKGLLNHWQKFTFSPSGGLRLKRDITEYGEFVRSFNAPSIDEKFELLGIMANVFIVAPESLASLFE 772  Japanese rice
EAW23549  761 STLDVFNQEVGLRLFTALCKHLKRQRVSIEGSLKLISDMNHYFKFIQSLKNNDLLLYFKAFRELAQIYLIDPSDAKELAT 840  Aspergillus fisch...
Q5BGH2    755 STLDVFNQEVGLRLFTALCKHLKRQRISIEGSLKLISDMNHYFKFIQRLKNNELLIYFKAFRELSQIYLIDSSDAKELAN 834  Aspergillus nidulans
Q2URB8    764 STLDVFNQEIGLRLFTALCKHLKRQRISVEGSLKLISDMNHYFKFIQRFKNNELLVYFKAFRELSQIYLIDPSDAKELAT 843  Aspergillus oryzae
Q4RLZ1    588 KNVDTVLTELGVRFHRLIHEHLQQYSYSSMGGMLAICDVAEYRRCAKDFRVPLVLQLFDTLHALCNLLVVAPDNLKQVCS 667  spotted green puf...
Q18406    550 ENLEALQSDLATRLFKFMLTHIQQFTYNSTGAVLLLCDVGELRTLVSKWRVQNALTQWESLQALTNLLAVLPDQVNETAH 629  Caenorhabditis el...
Q7PQN8    595 ENLAAVLTEFGIRYHRVVFEHLQQFQYNTAGAMCAICDVNEYRKSARVLQSPLVTQLFDVLHALCNLLLVKHENLQEVCG 674  Anopheles gambiae...
Q9XTM1    595 ENLQNVLTEFGTRLHRVIYDHLQTMQFNTAGAMCAICDVNEYRKCIRELDSPLVTQLFDILHALCNLLLVKPQNLQEVCT 674  fruit fly
5YFP_E    836 EGHLad-----iGRDIIQSYISNREDFN----HDNF 862  Saccharomyces cerevisiae S288C
X5JA13    790 GSPS--------IRKDAQRFIQLREDYKsaklATKL 817  thale cress
Q2QV94    773 GTPS--------IRKDALRFIQLRDDYKtakiASML 800  Japanese rice
EAW23549  841 IIADadrfygiwRVEEVYEFAERRADWFqvkrDVER 876  Aspergillus fischeri NRRL 181
Q5BGH2    835 FIADagrfsgiwRVEEVYEFAERRADWYqikrDVER 870  Aspergillus nidulans
Q2URB8    844 IIADsgrfqgiwTVEDVCEFAERRADWYqvkrDVER 879  Aspergillus oryzae
Q4RLZ1    668 GEQLtn-----lDRNLLHAFVQLRVDYRsarlGRHF 698  spotted green pufferfish
Q18406    630 SSLLen-----vDRQLIHDFVRLRTDFRsiknFQI- 659  Caenorhabditis elegans
Q7PQN8    675 GETLny-----lDKSVVMNFIQLRSDYKtikiSNSL 705  Anopheles gambiae str. PEST
Q9XTM1    675 GDTLny-----lDKSVVRQFIQLRTDFRiiknTNYL 705  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap