2DBI,4RGK


Conserved Protein Domain Family
DUF1479

?
pfam07350: DUF1479 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1479)
This family consists of several hypothetical Enterobacterial proteins, of around 420 residues in length. Members of this family are often known as YbiU. The function of this family is unknown.
Statistics
?
PSSM-Id: 399968
View PSSM: pfam07350
Aligned: 23 rows
Threshold Bit Score: 484.501
Threshold Setting Gi: 351637880
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DBI_A         56 A----AIRQMKHALRaqLGD----VQQIFNQLSDDIATRVAEINALKAQGDAVWPVLSYADIKAGHVT--AEQREQIKRR 125 Escherichia coli
ABN67932       27 Dy--eKFSELKRKLIkpEN-----IEKVKESWKRLLVAIEKKVEEIKNAKDSYIPEIEWKTIKENGNKfpEDIGKLFEER 99  Scheffersomyce...
XP_001385744   17 N----RFIDIKRSLVspEN-----IEKVTQSWKRLLRALEKQADTISEEGPKYVPQVDFKDIVANNNQlpDNVSALFKER 87  Scheffersomyce...
CAM02201       24 A----AIRRIKPALRarIASsgrtVEEVFVAVEHRIAARIAEIRADQARGEGVWPVVDYADVERGTVS--AEQRDKVRRR 97  Saccharopolysp...
tigr:AHA_3774  10 AdhkaAIRQMKQALRaqLGD----VEAVFAEVSRRIEARVAEVEALRARGEPVWPELDYRALAAGQVS--EAERAAIRRR 83  Aeromonas hydr...
Q63JK4         10 T----AIRTTKAVLRaaMPN----RAPVFRALEGDIARQADAILTDRAQGRDTIPVLRFADIAADRVD--PASLAALRTR 79  Burkholderia p...
Q4DXJ7         10 TdvraTIRDTKRMLRehLPT----YKEVFDEIEEFISAQVEIIKKEQAAGIASVPEVQAQDIFDGSVS--ESLKNKIRQR 83  Trypanosoma cruzi
4RGK_A         14 A----AIKAVKQQLRqaLPD----YQQVFQAVEENIRQQVXEIRRNLAEGKNPVPQLHADDIINGKVT--EEQKAQIKQR 83  Yersinia pestis
Q6BXT7         46 Q----EYAEVKKNLV---KN----KEAITASWHRLKKALADGIQEIKEVGPEIIPKVLFSELGNL--S--EEQTQQIKKR 110 Debaryomyces h...
XP_001484552   50 Q----KFTQLKKELV---KD----PQALKESWLRLKVALSKGIEEIKAKGPSIIPSVEFSKLDSL--S--EAERADIFKR 114 Meyerozyma gui...
2DBI_A        126 GCAVIKGHFPREQALGWDQSMLDYLDRNrfdev-ykgpgDNfFGTLS-ASRPEIYPIYWSQAQMQARQSEEMANAQSFLN 203 Escherichia coli
ABN67932      100 GCLIVRNVLDKDTVRGWYQQLSDFVSKH-----------PD-VGGYP--NPITNWFVFWNKAMIEARSHPEITQLMSVMS 165 Scheffersomyce...
XP_001385744   88 GTLMIHNVVDEEQIDTWFNELVGFCKEH-----------PE-TAGYTyPNPTAWYNVFWSKPQSEARFHPNTRALFKAMA 155 Scheffersomyce...
CAM02201       98 GCLVVRGHFDRDQALAWDAEIVDYVERNrffen-ysgpgDDfFGSVG--SKPEIYPIYWSNAQMQARQSDRMARVQAFLN 174 Saccharopolysp...
tigr:AHA_3774  84 GCLVIRGHFARERALAWDRDMLDYLDLNrfdel-yrgpgDSfFGSLA-ASRPEIYPIYWSRAQMEARQSDEMATVQSFLN 161 Aeromonas hydr...
Q63JK4         80 GACVIRGVFDARQASDWNDEIAAYVEANrlddklarraeDRyFGTLA-SSRPQIYGIYWSKPQIAARQSPALTQARVFLN 158 Burkholderia p...
Q4DXJ7         84 GCAVIHGVFPRDVAAKWNEDVKAYLDENnfeerlnhaavDKyFSELA-KGKPQIYGVYWSKPQVEARQSERMKAVQVFMN 162 Trypanosoma cruzi
4RGK_A         84 GCCAILGVFPQEKATAWNREIGDYLDRNnfverlknaaeDNyFGTLA-ASKPQIYGIYWSTPQVEARQDKRXQAVQIFLN 162 Yersinia pestis
Q6BXT7        111 GSLIIKNVIPKEEAIQLKKDVIDYIDAN-----------PN-TEGFP-KDKKVVYELYWSKSQVRARSHPHVTNVMSYMN 177 Debaryomyces h...
XP_001484552  115 GCVVIRNVVPKGKVVEWKNQVVDYTAKN-----------PT-TKGFP-KDSPVVYELYWSKAQVEARSHPNMMKTMNFMN 181 Meyerozyma gui...
2DBI_A        204 RLWTFe-sDGKQWFNPDVSVIYPDRIRRRPPGTTSKGLGAHTDSGALERWLLPAYQRVFANVFNGNLAQYDPWHAAHRTE 282 Escherichia coli
ABN67932      166 QFFYVk--DSNLPIDKDSQIVYPDAFRIRSPGQE-TTLDLHLDSGSIERWEDEGYRRVYAPIFEGRWEDFEPFELDSRSF 242 Scheffersomyce...
XP_001385744  156 NQFHVe--NEDSLIDINTQVVYGDRIRIREPGSV-ASLKLHLDSSSIERWEDEHYRQAYHEILEGNWEEWDAFRLDERTY 232 Scheffersomyce...
CAM02201      175 SFWKHe-sQGVRWFEPDRDALYPDRIRRRPPGSDSGGLGTHCDPGTLDLWMTRSHQQAFRHLFDGTVEQYDPWDAAHRTA 253 Saccharopolysp...
tigr:AHA_3774 162 RLWQFerpDGTPWFDPDVSIIYPDRIRRRPPGTCSRGLGAHTDSGALERWLLPAYQQVFASIFRGDIAAYDPWDAAHRTE 241 Aeromonas hydr...
Q63JK4        159 RLWRAq-sEGRVHFDPARAPAYADRIRRRPPGSSSLGLSPHVDGGSVERWLEPNYRRVYRHVLAGDWRAYDPFDAAFRPD 237 Burkholderia p...
Q4DXJ7        163 SFWKSe-sNGKQHFDPKNIVTYADRLRRRPPHSPPLGLSPHVDSGTIERWLDYKFRHVYRNVFSGNWEAHNPYDAEGRTE 241 Trypanosoma cruzi
4RGK_A        163 NLWQTe-sNGKQHFDANRVVTYADRTRRRPPKSSSLGLSPHVDGGSIERWLDENFRHVYRHVFSGQWQKYDPFAAEGRPE 241 Yersinia pestis
Q6BXT7        178 NLWHA---SPESEICFDQNISYADRLRIRKAGDALFSLGPHADGGSLERWEDEEYSNCYTPIFEGNWENFDPYDATHRIE 254 Debaryomyces h...
XP_001484552  182 HLWHT---DEDSLICLDKNLSYADRLRIRNAGDKFFSLGPHADGGSLERWEDKLYVQSYRKIFEGKWEEFDPYDIQGRLD 258 Meyerozyma gui...
2DBI_A        283 VEEYTV-----DNTTKCSVFRTFQGWTALSDMLPgqGLLHVVPIPE-AMAYVLLRPLLDDVP-------------EDELC 343 Escherichia coli
ABN67932      243 AKSDLYsh-lkTRPTATSAFRTLQGWLALTSVKSgeGTIRFLPNIKlVTAYSILRPFFWRDDgei-------dieTPKFP 314 Scheffersomyce...
XP_001385744  233 ANENLYehvltGKSTICSAFRTLQGWLALSNNKSgeGTLRVLPNLKmAMAYIILRPLFWRDPvsgdiddyeidleTPKFP 312 Scheffersomyce...
CAM02201      254 ASQYP-------GSTMCSAFRTFQGWTALSDMAHdqGVLHTVPIPE-AMAYLMLRPLLPDVP-------------DDDMC 312 Saccharopolysp...
tigr:AHA_3774 242 VEEYSV-----ENTTKCSVFRTFQGWTALSDMLPgqGLLHVVPIPE-AMAYVLLRPLQPDVP-------------EDELC 302 Aeromonas hydr...
Q63JK4        238 VEEIP-------SPAVCSMFRTFQGWTALTPQGPgdGTLQLIPVAN-AMAYVVLRALQDDVP-------------DDDLC 296 Burkholderia p...
Q4DXJ7        242 VREIK-------SPAMCSAFRTFQGWTALSPQRKngGTLRLVPIIN-AIPYMLLRSLQDDVP-------------EDDFC 300 Trypanosoma cruzi
4RGK_A        242 VREFP-------SPAVCSXFRTFQGWTALTPQRThaGTLNVIPIAN-AXAYILLRALQDDVA-------------DDDLC 300 Yersinia pestis
Q6BXT7        255 AKMDLH-----ESRGTCSMFRTFQGWLAVSDIAPkeGTILFAPLVReVTAYYMLKPFFDENDel---------rlDSDIP 320 Debaryomyces h...
XP_001484552  259 ADMDYY-----ESQGTCSIFRSFQGWLAASEIAPkeGSILFAPLVReVTAYYMLKPYFDENDel---------tlDGRMP 324 Meyerozyma gui...
2DBI_A        344 GVAPGRVLPVSEQW-HPL--LIEALTSIPKLEAGDSVWWHCDVIHSVAPVENQQGWGNVMYIPAAPMCEKNLAYAHKVKA 420 Escherichia coli
ABN67932      315 GAIVGSGQFFLSEKlHPHlkPLESVISIPYANESDYIFWHCDVAHEVDKVHNGKNISSVFYNALCPLAPYNVDNMIATRR 394 Scheffersomyce...
XP_001385744  313 GSVPSTGQLFLPEEyFPHlyHQKSVISIPDVRKGTFVFWHVDIPHEVDKEHNGEGHSSVFYYGQTPLSITNIRTILDTKK 392 Scheffersomyce...
CAM02201      313 GVTTNQVFPADRKW-HPM--LVEALTGIPDISAGDSVWWHCDMIHSVAPVTDQKGWGNVMYIPAAPWCPRNEAYSESVRE 389 Saccharopolysp...
tigr:AHA_3774 303 GVAPGKVLPVSETW-HPL--LLRAMSSIPAVTAGDSVWWHCDLIHGVAPVEQQQGWGNVMYIPAAPRCEKNMAYARLVRQ 379 Aeromonas hydr...
Q63JK4        297 GAQPGRALSVLPAW-HAP--LLAALVPIPPMEPGDAVFWHGDVVHAVEDAHRGTGYSNVMYIASAPGCAKNDAYLKRQLP 373 Burkholderia p...
Q4DXJ7        301 GAQPGRALGLSPEW-HSL--LLEAECPIPEMEPGDCVFWHCDLVHSVEAEHEGEFDSNVIYIACVPRCAKNVEYARAQWE 377 Trypanosoma cruzi
4RGK_A        301 GAAPGRALSASEQW-HPL--LXEAISPIPDLEAGDTVFWHCDVIHSVENEHNGEFDSNVXYIAAAPWCEKNAAYLPRQLA 377 Yersinia pestis
Q6BXT7        321 GAFPGKGLEFNDKT-HPEmdLNNLMVLVPKVEPGDMVFWHCDLVHAVDPVHIGENDSSVFYIPSVPLCGINVEYAFLQRE 399 Debaryomyces h...
XP_001484552  325 GAYPGKGLEFNDNT-HPElkLSDLMVHIPKVQPGDMVYWHCDLIHAVDNEHLGDHDSLVFYIPSAPLCQTNLKYALTQRE 403 Meyerozyma gui...
2DBI_A        421 ALEKGASPGDFPREDy-----ETNWEGRFTLAD--LNIH----GKRALGM 459 Escherichia coli
ABN67932      395 AFYRAECPRDFIKDRtqsgpsEGDFPGEHGDERniLTDV----GLRALGL 440 Scheffersomyces stipitis CBS 6054
XP_001385744  393 AFLNNKSPEDYSSQLs-----ETEKAKEYQGAD--INHIknieGMRSMGL 435 Scheffersomyces stipitis CBS 6054
CAM02201      390 AFRTGSSPGDFPEEHy-----EREWEGRFTPDQ--LNET----GRRGLGL 428 Saccharopolyspora erythraea NRRL 2338
tigr:AHA_3774 380 ALEQGASPGDFPREDy-----EADWQGRFTLAD--LNDH----GRRALDM 418 Aeromonas hydrophila subsp. hydrophila ATCC ...
Q63JK4        374 SFLRGESPPDFPADHf-----ETDFAGRARADD--LSAL----GREQMGf 412 Burkholderia pseudomallei
Q4DXJ7        378 AFLRGGSPPDFAADDf-----EVNFKGRARPED--LTPI----GRAQMDP 416 Trypanosoma cruzi
4RGK_A        378 SFIDGRSPPDFAADDf-----EVDFIGRATIKN--LTEI----GKQQLGi 416 Yersinia pestis
Q6BXT7        400 AFLNGLAGPDFP--GfphgtaETQHIGRGTPKD--VVETg---GKTAMRE 442 Debaryomyces hansenii
XP_001484552  404 AFLKGLVGPDFP--GfpndvaETQHKDRGGPED--VMEIggieALREFLL 449 Meyerozyma guilliermondii ATCC 6260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap