Conserved Protein Domain Family
DUF1475

?
pfam07343: DUF1475 
Protein of unknown function (DUF1475)
This family consists of several hypothetical plant proteins of around 250 residues in length. Members of this family seem to be found exclusively in Arabidopsis thaliana. The function of this family is unknown.
Statistics
?
PSSM-Id: 399963
View PSSM: pfam07343
Aligned: 2 rows
Threshold Bit Score: 438.703
Threshold Setting Gi: 75109824
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5VPL8   1 MAAAGSIGVYRAVFAALGALMLGTLVYTCVTDGSPFRLELLTPWLVATLIDFYVNVTAISTWVIYKEVNWISSFFWVVLL 80  Japanese rice
Q5VPL8   1 MAAAGSIGVYRAVFAALGALMLGTLVYTCVTDGSPFRLELLTPWLVATLIDFYVNVTAISTWVIYKEVNWISSFFWVVLL 80  Japanese rice
Q5VPL8  81 YCFGSIATCAYVVVKLFEIKTSGPSQDPLDLLFLRQGDLSERKSSFVIIGRIIFSILGAMMAAVVIYTVITDGLPFRKDL 160 Japanese rice
Q5VPL8  81 YCFGSIATCAYVVVKLFEIKTSGPSQDPLDLLFLRQGDLSERKSSFVIIGRIIFSILGAMMAAVVIYTVITDGLPFRKDL 160 Japanese rice
Q5VPL8 161 LTPWMAATLIDFYINVFAISVWVAHKESNWISTAIWICLLICFGSITTCGYIVIQLFQVSYRDPIYHVLLNSHNKS 236 Japanese rice
Q5VPL8 161 LTPWMAATLIDFYINVFAISVWVAHKESNWISTAIWICLLICFGSITTCGYIVIQLFQVSYRDPIYHVLLNSHNKS 236 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap