Conserved Protein Domain Family
DUF1473

?
pfam07341: DUF1473 
Protein of unknown function (DUF1473)
This family consists of several hypothetical bacterial proteins of around 150 residues in length. Members of this family seem to be found exclusively in Borrelia burgdorferi (Lyme disease spirochete). The function of this family is unknown.
Statistics
?
PSSM-Id: 115964
View PSSM: pfam07341
Aligned: 2 rows
Threshold Bit Score: 216.426
Threshold Setting Gi: 75362603
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6ASH9   1 MRYKLKILTRAKTHKYVLKDIPMYEWDNVLGFdVERDElINKLNDLKTLKEITKLMISRGFLDEFYEILNKERRYSELYK 80  Borreliella garinii
Q5XYW5   3 MRYKMKILTKNKTYEYPLKVLPVYEWDRVLGF-NQSDA-VLKLNEVQYLREITSLMISPKFLDEFYVILDQNREFISYYK 80  Borreliella garinii
Q6ASH9  81 YALPIILFLVQYSLFQTIEGFKKPGLVYIESFQDRNGDYIKYDYIDERWSYDFLITSSKSLGLNQedsleanlepllKEG 160 Borreliella garinii
Q5XYW5  81 DYLVAIIYTAQFNTFHLDNDLKKPALVYLSEYENNVGDFVTFDYINENFEYEKVATSLSSSTSNS------------NEL 148 Borreliella garinii
Q6ASH9 161 VNE 163 Borreliella garinii
Q5XYW5 149 VAK 151 Borreliella garinii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap