Conserved Protein Domain Family
DUF1472

?
pfam07339: DUF1472 
Protein of unknown function (DUF1472)
This family consists of several Enterobacterial proteins of around 125 residues in length and contains 6 highly conserved cysteine residues. The function of this family is unknown.
Statistics
?
PSSM-Id: 115962
View PSSM: pfam07339
Aligned: 2 rows
Threshold Bit Score: 166.308
Threshold Setting Gi: 119368812
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9JMR5    74 AWPCGFSVMWPPCRVRAVPCLHLSRAGGDARVRFAAAVTRSLLPVCRDFPVVHPLRFRGLTLQLPSAVCVRLRLPLRPVH 153 Escherichia coli K-12
EFU32731  25 AWPCGFSALWPQRRVRAVPCLHLSRAGRDARVRFAAAVTRSLLPVCRDFPVVHPLRFRGLTLQLPPAVCVRLRLPLRPVH 104 Escherichia coli MS...
Q9JMR5   154 PRLIARLLWRHGTARCRGICE 174 Escherichia coli K-12
EFU32731 105 PRLIARLLWRHGTARCRRTCD 125 Escherichia coli MS 85-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap