Conserved Protein Domain Family
Curto_V2

?
pfam07325: Curto_V2 
Curtovirus V2 protein
This family consists of several Curtovirus V2 proteins. The exact function of V2 is unclear but it is known that the protein is required for a successful host infection process.
Statistics
?
PSSM-Id: 148753
View PSSM: pfam07325
Aligned: 2 rows
Threshold Bit Score: 225.692
Threshold Setting Gi: 81923363
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O72688   1 MGPFRVDQFPDNYPAFLAVSTSCFLRYNKWCILGIHQEIEALTLEEGEVFLQFQKEVKKLLRLKVNFQRKCSLYEKIYKK 80  Beet severe curly top...
Q68540   1 MGPFTVGQFPRNYPALLAVSTSCFFRYNKWCILGIRHEVESLTLEEGEAFLGFQKEVKKLLKRKCTFSRKCELYEEIYKK 80  Horseradish curly top...
O72688  81 YVYNVPEKKGESSKCVAEEEEDyYEFEEIPMEETCDKKQDSEVKDV 126 Beet severe curly top virus - Cfh [Beta]
Q68540  81 YLSDGPEEKGSLPTVMVEEEED-WAHEKIPMEEACSQDEGPEIEDV 125 Horseradish curly top virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap