3CTW


Conserved Protein Domain Family
DUF1465

?
pfam07323: DUF1465 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1465)
This family consists of several hypothetical bacterial proteins of around 180 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399955
View PSSM: pfam07323
Aligned: 35 rows
Threshold Bit Score: 142.737
Threshold Setting Gi: 123491171
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CTW_D                           17 IQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLS----RNAALGYATESMRLTTRLMQVASWLLVQRAVREGEM 92  Caulobacter vibrioides...
jgi:Rvan_3195                    19 GDRFTTSPQFAKLYREGMDLVERTAEYLDGQGRAESKTLT----PPASFAYSSESIRLTTRLTQLASWLLVRRAIAAGEI 94  Rhodomicrobium vannielii ATCC 17100...
WP_023787293                     21 GERFQASEQFDRVFSQGMGLVERAAAYLDGEGRRESKGLP----GPVTVLYATESMRLTTRLLELASWLLIRRALKEGEI 96  Hyphomicrobium nitrativorans...
jgi:Plav_2094                    22 LAEFMASGLFQRTYNEGMRLVEETSAYLDGPGRQAARGLP----REASLAYAGESMRLTTRLMQVASWLLVRKAVHEGEM 97  Parvibaculum lavamentivorans DS-1...
dbos:1099484000100_PB2503_02047  19 lAPFVRSKVFTNLFAQGMELVEETAGYLDNTGRAAARELS----REAQMTYAGVSMRLTTRLMQIASWLLVLRAVRDGEM 94  Parvularcula bermudensis HTCC2503...
jgi:Swit_0575                     6 keirLRGRLVNSLYTEAMLLADEARGYFEHRGRDDREALD----PLARVTLSCESLKVTSRLMHVLAWLLTERAIELGQM 81  Sphingomonas wittichii RW1...
WP_014075524                      7 llhQFDRRLIDSLYVEAMVLADEARSFFDHRAEEHRAVLS----QIDRVEFACESLKVTTRLMHIIAWLLTQRAIIHGEL 82  Sphingobium sp. SYK-6...
BAI96111                          7 ldqGLHRRLVDGLYVEAMVMADEARAYFDLRDGGDADVDD----PVRRVAFACESLKVTTRLMHIIAWLLSQRAWQRGEL 82  Sphingobium japonicum UT26S...
ELS:G432_17545                    3 vdgRMAARLVDSLYLEAMVLADEVRAYFDEPGRAERDALS----PLARVSFSCESLKVTTRLMHVIAWLLVRKAVEAGEL 78  Sphingomonas sp. MM-1...
Q2GC91                           15 FMPSLNPRIVDALHAQALGLADAVRTRFEALRREALDAAGsdceDLHRVRVSCEALRTTTRVMHCLAWLLNHRAYFAGEL 94  Novosphingobium aromaticivorans DSM 12444...
3CTW_D                           93 PPEAACAEAYRLAEEA---PADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPNEEA---PRPVQNQLDRLTAA 166 Caulobacter vibrioides...
jgi:Rvan_3195                    95 TAAEAHNHRHRVTLSPq-sTTLPEGFDALPKTFRFLIAESQRLHDRIMRLERIFSDGAVAANEm--ASPIGPQIERIRLA 171 Rhodomicrobium vannielii ATCC 17100...
WP_023787293                     97 TAEEAETKRARVKLQTlgrPNHTRGFDDLPQGLRDLIEASFTLHDRIVQLDRAMLPAADDARPaehANPVATQISALEKA 176 Hyphomicrobium nitrativorans...
jgi:Plav_2094                    98 SAEEANSEKYRLATKEiarQPRFDGVDTLPQPLQELIGRSERLYARVERLDARLREGVSPIAQ---DHPLAEQLRRVEL- 173 Parvibaculum lavamentivorans DS-1...
dbos:1099484000100_PB2503_02047  95 SEDEAADEKYRVGPAEp-gGKSATDVDVLPEELLELIAETDTLYTRIRRLDHDLFDDAAGRDSh--AGDAQTRLAALQQA 171 Parvularcula bermudensis HTCC2503...
jgi:Swit_0575                    82 SDEEAAAAARRLGDAT---PSDAISTAGLPPAAIALIDASQDLYARVRRLEVEPPVDVAPA-----ASPALSLLDRLEKA 153 Sphingomonas wittichii RW1...
WP_014075524                     83 PESSRTDAHHRLGEAA---STPAGMTARFSEEMAGLIGASEDLYQRVARLERQFVGRADGALPm-pTGPARDLLTRLERA 158 Sphingobium sp. SYK-6...
BAI96111                         83 SDAEMLDEKYRLGHAA---TTDPSVVGGFPFAARALIDGSQDLYERVARLQDRMARPRAQAE----PNPARALMDRLNAA 155 Sphingobium japonicum UT26S...
ELS:G432_17545                   79 TPEQAREPGRRLGGAH---DSDPQVVADLPPTARHLIAASRDLYDRVDRLDRDMGGFRAV------PSPARSLVERLQQA 149 Sphingomonas sp. MM-1...
Q2GC91                           95 SQLQLRRHGRLITNFP---ASEPEVVASLPDDARTLVHESERLYERIQRLENAWRTQGASS-----ESAIDALRQRLVRA 166 Novosphingobium aromaticivorans DSM 12444...
3CTW_D                          167 F 167 Caulobacter vibrioides
jgi:Rvan_3195                   172 F 172 Rhodomicrobium vannielii ATCC 17100
WP_023787293                    177 F 177 Hyphomicrobium nitrativorans
jgi:Plav_2094                   174 F 174 Parvibaculum lavamentivorans DS-1
dbos:1099484000100_PB2503_02047 172 F 172 Parvularcula bermudensis HTCC2503
jgi:Swit_0575                   154 F 154 Sphingomonas wittichii RW1
WP_014075524                    159 F 159 Sphingobium sp. SYK-6
BAI96111                        156 F 156 Sphingobium japonicum UT26S
ELS:G432_17545                  150 F 150 Sphingomonas sp. MM-1
Q2GC91                          167 v 167 Novosphingobium aromaticivorans DSM 12444
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap